(data stored in ACNUC7421 zone)

EMBL: CP000478.PE314

CP000478.PE314       Location/Qualifiers
FT   CDS             380716..381132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0317"
FT                   /product="Roadblock/LC7 family protein"
FT                   /note="PFAM: Roadblock/LC7 family protein; KEGG: dps:DP2777
FT                   similar to gliding motility regulatory protein (MglB)"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16018"
FT                   /db_xref="GOA:A0LF16"
FT                   /db_xref="InterPro:IPR004942"
FT                   /db_xref="InterPro:IPR037587"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF16"
FT                   /protein_id="ABK16018.1"
FT                   /translation="MSLIVTREQILQLESIVGKELLDAGADHVIIVDMSGNLIMQQGSM
FT                   HMEDIFSLAALSAANFAATAEIAKLIGEEDFSLLFHKGDKRNIHFSRLGREHIIITLFN
FT                   ESVSLGLIRLKLNRAIEQMASIFKGLEGKNKWPL"
     MSLIVTREQI LQLESIVGKE LLDAGADHVI IVDMSGNLIM QQGSMHMEDI FSLAALSAAN        60
     FAATAEIAKL IGEEDFSLLF HKGDKRNIHF SRLGREHIII TLFNESVSLG LIRLKLNRAI       120
     EQMASIFKGL EGKNKWPL                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page