(data stored in ACNUC7421 zone)

EMBL: CP000478.PE317

CP000478.PE317       Location/Qualifiers
FT   CDS             385139..386773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0321"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: protein kinase; SMART: serine/threonine
FT                   protein kinase; KEGG: gka:GK1176 serine/threonine protein
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16021"
FT                   /db_xref="GOA:A0LF19"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF19"
FT                   /protein_id="ABK16021.1"
FT                   /translation="MAYGDLFQSYLNRLEEARLYLEQGLGEGAGEIVKGILEDLEQSAL
FT                   SEEEKSDLRSRIEKQHGHIPEETAAGEPPSAPQGPAYGMAEPDQTFEYGLALMDGQFWD
FT                   EAIREFKTAAAVGFRVMQCWELCGDCAGKLGKWDEAIRYYENIYADPAADEQLKRQILL
FT                   KITKCSQNRKKNDVSSTIQARSEAVAAAAAGPAPPPKVAKPESETLSPSLSSLDQHSLD
FT                   QLIGQHAASWNDSRNSFVAGEKHTYTISNLLHVGVTSLVMQVTDDDTGEMLAGQILSGP
FT                   YGAGVDPAVLSRWARAQMMSNSQHIVRIHDIAQCEDRIFIIREHLPLSLVDIFNMGEVL
FT                   PIPLAIGLSYQILEGIGDLHLHMGKDEEIRKIHHLDLRPSKILLHDDRFLVKICNGGLL
FT                   SELERANPRAASLKHLPLPLLAYRAPEQFRPYLSRKKPPFFTDIYLFGALLYEMLTGIQ
FT                   AFSGSSIEEFEIQHCEQYPTPPKVWRPEIPEVMNEIIMNCLICDPMKRWRSATQISLTF
FT                   EKSFSEWVGRGVERQYYELLDRLRSKI"
     MAYGDLFQSY LNRLEEARLY LEQGLGEGAG EIVKGILEDL EQSALSEEEK SDLRSRIEKQ        60
     HGHIPEETAA GEPPSAPQGP AYGMAEPDQT FEYGLALMDG QFWDEAIREF KTAAAVGFRV       120
     MQCWELCGDC AGKLGKWDEA IRYYENIYAD PAADEQLKRQ ILLKITKCSQ NRKKNDVSST       180
     IQARSEAVAA AAAGPAPPPK VAKPESETLS PSLSSLDQHS LDQLIGQHAA SWNDSRNSFV       240
     AGEKHTYTIS NLLHVGVTSL VMQVTDDDTG EMLAGQILSG PYGAGVDPAV LSRWARAQMM       300
     SNSQHIVRIH DIAQCEDRIF IIREHLPLSL VDIFNMGEVL PIPLAIGLSY QILEGIGDLH       360
     LHMGKDEEIR KIHHLDLRPS KILLHDDRFL VKICNGGLLS ELERANPRAA SLKHLPLPLL       420
     AYRAPEQFRP YLSRKKPPFF TDIYLFGALL YEMLTGIQAF SGSSIEEFEI QHCEQYPTPP       480
     KVWRPEIPEV MNEIIMNCLI CDPMKRWRSA TQISLTFEKS FSEWVGRGVE RQYYELLDRL       540
     RSKI                                                                    544
//

If you have problems or comments...

PBIL Back to PBIL home page