(data stored in ACNUC7421 zone)

EMBL: CP000478.PE318

CP000478.PE318       Location/Qualifiers
FT   CDS             387069..387344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0322"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mbu:Mbur_2240 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16022"
FT                   /db_xref="InterPro:IPR021734"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF20"
FT                   /protein_id="ABK16022.1"
FT                   /translation="MLFLAIFSYSPEDRDDVIQRGMGTGTKHQGVEVKGEWFDISGHRV
FT                   FRLFEADDEVHLAASVYAWTDLGIAEIIPVMETEKALKFLKRVGTK"
     MLFLAIFSYS PEDRDDVIQR GMGTGTKHQG VEVKGEWFDI SGHRVFRLFE ADDEVHLAAS        60
     VYAWTDLGIA EIIPVMETEK ALKFLKRVGT K                                       91
//

If you have problems or comments...

PBIL Back to PBIL home page