(data stored in ACNUC7421 zone)

EMBL: CP000478.PE32

CP000478.PE32        Location/Qualifiers
FT   CDS             47379..47846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0033"
FT                   /product="putative transcriptional regulator, ModE family"
FT                   /note="PFAM: regulatory protein, LysR; KEGG: dvu:DVU1759
FT                   molybdenum-binding protein, HTH domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15736"
FT                   /db_xref="GOA:A0LE84"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0LE84"
FT                   /protein_id="ABK15736.1"
FT                   /translation="MPSQSQEDSAARPARRSESKGKTKPVEVLNEPTIRLHIWLETGDG
FT                   VFFGAGRAFLLEKIEEHGSLRKAAEDLGMSYRAAWGKIRKTEKVLGVKLIAQCRSKKEG
FT                   HNLTEEGRMLKEKYLLWFQEIEREALRKAAEIFPWPVRGYKEKGGDKFLRQ"
     MPSQSQEDSA ARPARRSESK GKTKPVEVLN EPTIRLHIWL ETGDGVFFGA GRAFLLEKIE        60
     EHGSLRKAAE DLGMSYRAAW GKIRKTEKVL GVKLIAQCRS KKEGHNLTEE GRMLKEKYLL       120
     WFQEIEREAL RKAAEIFPWP VRGYKEKGGD KFLRQ                                  155
//

If you have problems or comments...

PBIL Back to PBIL home page