(data stored in ACNUC7421 zone)

EMBL: CP000478.PE320

CP000478.PE320       Location/Qualifiers
FT   CDS             389099..389299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0324"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16024"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF22"
FT                   /protein_id="ABK16024.1"
FT                   /translation="MTTVMPEGEAIRRAVKWISASLEEHPDKAAQSLVQEAVLRFDLSP
FT                   KETEFLMEFYKKAKPDASSDA"
     MTTVMPEGEA IRRAVKWISA SLEEHPDKAA QSLVQEAVLR FDLSPKETEF LMEFYKKAKP        60
     DASSDA                                                                   66
//

If you have problems or comments...

PBIL Back to PBIL home page