(data stored in ACNUC7421 zone)

EMBL: CP000478.PE326

CP000478.PE326       Location/Qualifiers
FT   CDS             393986..394276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16030"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF28"
FT                   /protein_id="ABK16030.1"
FT                   /translation="MGASHVAQSRFRLNGKVSEPAFNSPCLLPNPRLAGPRCASNGTPG
FT                   RPEFHGFCRGDRRGPPGGCIIEAGTGVFGLGLQEYFVNGLYSLKIFKVKAL"
     MGASHVAQSR FRLNGKVSEP AFNSPCLLPN PRLAGPRCAS NGTPGRPEFH GFCRGDRRGP        60
     PGGCIIEAGT GVFGLGLQEY FVNGLYSLKI FKVKAL                                  96
//

If you have problems or comments...

PBIL Back to PBIL home page