(data stored in ACNUC7421 zone)

EMBL: CP000478.PE328

CP000478.PE328       Location/Qualifiers
FT   CDS             complement(395006..395467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0332"
FT                   /product="Cache, type 2 domain protein"
FT                   /note="PFAM: Cache, type 2 domain protein; KEGG:
FT                   ade:Adeh_3161 cache domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16032"
FT                   /db_xref="InterPro:IPR033480"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF30"
FT                   /protein_id="ABK16032.1"
FT                   /translation="MSKKLLIAVVIVVLGLSWAYAQQQQAVDEKALAKAMVEKAAAFLN
FT                   ENGKEKTIAEINKPDGQFVQGELYVFAYDLNAVMLAHPKNPKLIGQSLMDKPDSKGKLF
FT                   RKEIIDKAKSAGSGWVDYFYLNPQTGKEEAKTTYLKKAGDMVICCGAYR"
     MSKKLLIAVV IVVLGLSWAY AQQQQAVDEK ALAKAMVEKA AAFLNENGKE KTIAEINKPD        60
     GQFVQGELYV FAYDLNAVML AHPKNPKLIG QSLMDKPDSK GKLFRKEIID KAKSAGSGWV       120
     DYFYLNPQTG KEEAKTTYLK KAGDMVICCG AYR                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page