(data stored in ACNUC7421 zone)

EMBL: CP000478.PE329

CP000478.PE329       Location/Qualifiers
FT   CDS             396201..396512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0333"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16033"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF31"
FT                   /protein_id="ABK16033.1"
FT                   /translation="MSFEQWGYEFDGAYSVADRLQPRAGVYVVWCKIEDKWKVIGVGQS
FT                   ENVGKQLVDGERTLCWADECKPGTIYFAATYTDGAPESERKCIEQLIRRLTNNLREGA"
     MSFEQWGYEF DGAYSVADRL QPRAGVYVVW CKIEDKWKVI GVGQSENVGK QLVDGERTLC        60
     WADECKPGTI YFAATYTDGA PESERKCIEQ LIRRLTNNLR EGA                         103
//

If you have problems or comments...

PBIL Back to PBIL home page