(data stored in ACNUC7421 zone)

EMBL: CP000478.PE33

CP000478.PE33        Location/Qualifiers
FT   CDS             47918..48721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0034"
FT                   /product="formate dehydrogenase family accessory protein
FT                   FdhD"
FT                   /note="TIGRFAM: formate dehydrogenase family accessory
FT                   protein FdhD; PFAM: formate dehydrogenase, subunit FdhD;
FT                   KEGG: dde:Dde_3516 formate dehydrogenase family accessory
FT                   protein FdhD"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15737"
FT                   /db_xref="GOA:A0LE85"
FT                   /db_xref="InterPro:IPR003786"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:A0LE85"
FT                   /protein_id="ABK15737.1"
FT                   /translation="MQTLKHMTARFKDNGLFSAENELAVEELLEIYVDDSPYAITMRLP
FT                   GDDINLAAGFCFTEGIIRSYDDIASIEHCEAIPGERRVMVHLSRDRKRAKSVRKERAEY
FT                   LSKSSCGLCGKREAEEIFDDIPPVETCRHIELEEILRLKDVFEGRQAIFPRTGSTHSAA
FT                   AFDDRANLLAFAEDIGRHNAFDKVIGALLKTRELGKVFLGVVSSRLSFEMVQKAGVAGF
FT                   EVFAGLSAATSLAVAMADRLNMTLIGFLREKSMSIYTHPERVLRC"
     MQTLKHMTAR FKDNGLFSAE NELAVEELLE IYVDDSPYAI TMRLPGDDIN LAAGFCFTEG        60
     IIRSYDDIAS IEHCEAIPGE RRVMVHLSRD RKRAKSVRKE RAEYLSKSSC GLCGKREAEE       120
     IFDDIPPVET CRHIELEEIL RLKDVFEGRQ AIFPRTGSTH SAAAFDDRAN LLAFAEDIGR       180
     HNAFDKVIGA LLKTRELGKV FLGVVSSRLS FEMVQKAGVA GFEVFAGLSA ATSLAVAMAD       240
     RLNMTLIGFL REKSMSIYTH PERVLRC                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page