(data stored in ACNUC7421 zone)

EMBL: CP000478.PE335

CP000478.PE335       Location/Qualifiers
FT   CDS             complement(399494..400816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0339"
FT                   /product="cytochrome bd ubiquinol oxidase, subunit I"
FT                   /note="PFAM: cytochrome bd ubiquinol oxidase, subunit I;
FT                   KEGG: dde:Dde_3204 cytochrome d ubiquinol oxidase, subunit
FT                   I"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16039"
FT                   /db_xref="GOA:A0LF37"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF37"
FT                   /protein_id="ABK16039.1"
FT                   /translation="MMDVLMLSRLQFAAATFFHFLFVPLTLGLSILIAVMETIYVRTGD
FT                   EEYRNMARFWGKIFLINFAIGVVTGITLEFQFGTNWSRYSRYVGDIFGSLLAIEATVAF
FT                   FLESTFIAVWALGWKRLSPKAHAATIWLVAVASNVSAFWILIANAWMQHPVGYTIRNGR
FT                   AELTDFTAIVTQSFALNEIVHTLGAAYILTAFFMMGISAYHLLRKQHVAFFTRSFRMAV
FT                   TFGLIFAVVEVVQGHMHGAEVARVQPAKLAAMEALWDTTAQAPQHLFLIPDEKNETNLA
FT                   VFGTIPGALSMLAYHDPKATVKGLKDFPPEERPPVTLPFAAFRIMISLGFLFLFLTAYG
FT                   WIRRDRLMESPRYLKLMLFAVPLPYLAIQAGWALAEVGRQPWVVYGVMKTADAVSKLSA
FT                   SQVWASFLGFIVVYTLLGIAAFTLIVSTARKGPETHPATAQ"
     MMDVLMLSRL QFAAATFFHF LFVPLTLGLS ILIAVMETIY VRTGDEEYRN MARFWGKIFL        60
     INFAIGVVTG ITLEFQFGTN WSRYSRYVGD IFGSLLAIEA TVAFFLESTF IAVWALGWKR       120
     LSPKAHAATI WLVAVASNVS AFWILIANAW MQHPVGYTIR NGRAELTDFT AIVTQSFALN       180
     EIVHTLGAAY ILTAFFMMGI SAYHLLRKQH VAFFTRSFRM AVTFGLIFAV VEVVQGHMHG       240
     AEVARVQPAK LAAMEALWDT TAQAPQHLFL IPDEKNETNL AVFGTIPGAL SMLAYHDPKA       300
     TVKGLKDFPP EERPPVTLPF AAFRIMISLG FLFLFLTAYG WIRRDRLMES PRYLKLMLFA       360
     VPLPYLAIQA GWALAEVGRQ PWVVYGVMKT ADAVSKLSAS QVWASFLGFI VVYTLLGIAA       420
     FTLIVSTARK GPETHPATAQ                                                   440
//

If you have problems or comments...

PBIL Back to PBIL home page