(data stored in ACNUC7421 zone)

EMBL: CP000478.PE338

CP000478.PE338       Location/Qualifiers
FT   CDS             complement(402002..403336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0342"
FT                   /product="sigma54 specific transcriptional regulator, Fis
FT                   family"
FT                   /note="KEGG: sat:SYN_01181 transcriptional regulator with
FT                   sigma 54 interaction domain; TIGRFAM: PAS sensor protein;
FT                   PFAM: sigma-54 factor, interaction domain-containing
FT                   protein; helix-turn-helix, Fis-type; ATPase associated with
FT                   various cellular activities, AAA_5; PAS fold-4 domain
FT                   protein; PAS fold domain protein; SMART: PAS domain
FT                   containing protein; PAC repeat-containing protein; AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16042"
FT                   /db_xref="GOA:A0LF40"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF40"
FT                   /protein_id="ABK16042.1"
FT                   /translation="MSDRAFDRILADKRNLEHILDNLMEGIISHDRNRRILFFNRAAEN
FT                   ITGYAREEVIGRDCHEVFGSPFCGQRCSFCGESPDLIDHKSYVVNILTRKGEPRRIEMS
FT                   VTGMVDEDGRFLGVLAAFRDLTDLFGMKLRLGEINSFAGIIGKDHKMLQVFDQIRDLAT
FT                   NDFPVHISGETGTGKELAAAAIHNESHRGGGPFVPVNCGALPEGLLESELFGHVKGAFT
FT                   GAIRDKKGRFELAHGGSIFLDEVSELPRFMQVKLLRVLQEGTFTRVGGESTIVVDVRVI
FT                   SASNRDLKKEVESHNFREDLYYRLNVVPIRIPPLRERKNDIPLLAAHFLEQAVKRGQKS
FT                   AVLSEDALAAMMDYSWPGNVRELQNAVYFALVKSRGSTLHVDDLPLELARTAPICKPGP
FT                   ARKLDRDSVAAALKQSGGNKARAARLLGVGRATLYRFLDDFENVP"
     MSDRAFDRIL ADKRNLEHIL DNLMEGIISH DRNRRILFFN RAAENITGYA REEVIGRDCH        60
     EVFGSPFCGQ RCSFCGESPD LIDHKSYVVN ILTRKGEPRR IEMSVTGMVD EDGRFLGVLA       120
     AFRDLTDLFG MKLRLGEINS FAGIIGKDHK MLQVFDQIRD LATNDFPVHI SGETGTGKEL       180
     AAAAIHNESH RGGGPFVPVN CGALPEGLLE SELFGHVKGA FTGAIRDKKG RFELAHGGSI       240
     FLDEVSELPR FMQVKLLRVL QEGTFTRVGG ESTIVVDVRV ISASNRDLKK EVESHNFRED       300
     LYYRLNVVPI RIPPLRERKN DIPLLAAHFL EQAVKRGQKS AVLSEDALAA MMDYSWPGNV       360
     RELQNAVYFA LVKSRGSTLH VDDLPLELAR TAPICKPGPA RKLDRDSVAA ALKQSGGNKA       420
     RAARLLGVGR ATLYRFLDDF ENVP                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page