(data stored in ACNUC7421 zone)

EMBL: CP000478.PE339

CP000478.PE339       Location/Qualifiers
FT   CDS             complement(403852..406767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0343"
FT                   /product="DnaK-related protein"
FT                   /note="KEGG: mca:MCA1306 DnaK-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16043"
FT                   /db_xref="GOA:A0LF41"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR021030"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF41"
FT                   /protein_id="ABK16043.1"
FT                   /translation="MTANASMEAETPSFQYIIGIDLGTTNSAVGYVDLSASGADDAAVR
FT                   FLEIPQLVAPGELGNRPVLPSFLYLPGPYELPPGSTALPWAPERSYAVGEFAREQGALV
FT                   PGRLVSSAKSWLCHGGVDRTHAILPWGAAENLDRISPIEASSRILLHIREAWNEVMAHG
FT                   REEHFLEEQLVVLTVPASFDEVARELTVRAAHEAGIRRIVLIEEPLAAFYAWLWKHEAD
FT                   WRTLMRPGQLILVCDVGGGTSDFTVIAIREDALGLRLDRLAVGEHLMLGGDNMDLALAR
FT                   HVEEVMQGGTGRLDSRRWQQLWHHCRKAKETLLGTVESAGPPAGRPSAPDSVDLTIVGS
FT                   GGRLIAGTLTATLSRETVKELTLDGFFPFTNLDDVSPPAAGAVLSEGGLPYVGDPAVTR
FT                   HMAAFWRRHRPLLLRETGRSRLYPDFLLFNGGALIPETIRDRLLRVVREWFRAEAGDEW
FT                   SPVELENPRPDLSVAIGAAYYGRVRLGRGVRVGAGSPRTFYVEVAPPGDRTVEEGHRTA
FT                   VCLLPRGAEEGYEAELERPEFQVRTNQPVSFGVLASSTRIGDSPGEILSLPNHELTVLP
FT                   PIRTALRYGRKGSAAALPVRLAVHLTDIGTLELWCRSTSGPHRWQLQFDVRHNAEDETR
FT                   PSPAGETFEAGRIDEAGAAIAAVFRRSAGRTLRPPERLVKDLVEIFEVKRERWPASLVR
FT                   KLADALLEDREGRSLTAQHEARWLNLLGFCLRPGYGDPLDEWRAKEAWKLYPAGLSFAR
FT                   QPQNRSEWWIFWRRAAGGLSAGQQQRICQEVLPGLQLEEQRKKGTTRKGGAPRTVQEEL
FT                   ETWMMLANLERLPAAVKTSLGRLMLRRLQRGAPRPQELWTFARFGARVPFYGPLDQTVP
FT                   REEAALWLAALLDLDLEPTQPLARTLVSLSRLTGDRARDLDRADRDRVLRRLESIPGTS
FT                   HLRALVNDARTDLEGTEREWLYGESLPSGLIVVEGAETVEP"
     MTANASMEAE TPSFQYIIGI DLGTTNSAVG YVDLSASGAD DAAVRFLEIP QLVAPGELGN        60
     RPVLPSFLYL PGPYELPPGS TALPWAPERS YAVGEFAREQ GALVPGRLVS SAKSWLCHGG       120
     VDRTHAILPW GAAENLDRIS PIEASSRILL HIREAWNEVM AHGREEHFLE EQLVVLTVPA       180
     SFDEVARELT VRAAHEAGIR RIVLIEEPLA AFYAWLWKHE ADWRTLMRPG QLILVCDVGG       240
     GTSDFTVIAI REDALGLRLD RLAVGEHLML GGDNMDLALA RHVEEVMQGG TGRLDSRRWQ       300
     QLWHHCRKAK ETLLGTVESA GPPAGRPSAP DSVDLTIVGS GGRLIAGTLT ATLSRETVKE       360
     LTLDGFFPFT NLDDVSPPAA GAVLSEGGLP YVGDPAVTRH MAAFWRRHRP LLLRETGRSR       420
     LYPDFLLFNG GALIPETIRD RLLRVVREWF RAEAGDEWSP VELENPRPDL SVAIGAAYYG       480
     RVRLGRGVRV GAGSPRTFYV EVAPPGDRTV EEGHRTAVCL LPRGAEEGYE AELERPEFQV       540
     RTNQPVSFGV LASSTRIGDS PGEILSLPNH ELTVLPPIRT ALRYGRKGSA AALPVRLAVH       600
     LTDIGTLELW CRSTSGPHRW QLQFDVRHNA EDETRPSPAG ETFEAGRIDE AGAAIAAVFR       660
     RSAGRTLRPP ERLVKDLVEI FEVKRERWPA SLVRKLADAL LEDREGRSLT AQHEARWLNL       720
     LGFCLRPGYG DPLDEWRAKE AWKLYPAGLS FARQPQNRSE WWIFWRRAAG GLSAGQQQRI       780
     CQEVLPGLQL EEQRKKGTTR KGGAPRTVQE ELETWMMLAN LERLPAAVKT SLGRLMLRRL       840
     QRGAPRPQEL WTFARFGARV PFYGPLDQTV PREEAALWLA ALLDLDLEPT QPLARTLVSL       900
     SRLTGDRARD LDRADRDRVL RRLESIPGTS HLRALVNDAR TDLEGTEREW LYGESLPSGL       960
     IVVEGAETVE P                                                            971
//

If you have problems or comments...

PBIL Back to PBIL home page