(data stored in ACNUC7421 zone)

EMBL: CP000478.PE34

CP000478.PE34        Location/Qualifiers
FT   CDS             49011..49598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0035"
FT                   /product="Formate dehydrogenase"
FT                   /EC_number="1.17.1.9"
FT                   /note="PFAM: molybdopterin oxidoreductase Fe4S4 region;
FT                   KEGG: sat:SYN_00635 formate dehydrogenase major subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15738"
FT                   /db_xref="GOA:A0LE86"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="UniProtKB/TrEMBL:A0LE86"
FT                   /protein_id="ABK15738.1"
FT                   /translation="MGVTRREFLLISGTMGAGLALSSLGVDMRPIMAHAEELSKIEKVK
FT                   SAKQTYSLCYYCSVTCGLICSTDQKTGKIINIEGDPDHPVTEGSLCAKGAASLQMSARN
FT                   EHRLTKVLYRKPGGDKWEPKTMDWALTEIAKRIKATRDKDFMVKNAKGQVVNRLESISH
FT                   LGSSKLDNEECWMVTAAVRALGLVYIDHQARV"
     MGVTRREFLL ISGTMGAGLA LSSLGVDMRP IMAHAEELSK IEKVKSAKQT YSLCYYCSVT        60
     CGLICSTDQK TGKIINIEGD PDHPVTEGSL CAKGAASLQM SARNEHRLTK VLYRKPGGDK       120
     WEPKTMDWAL TEIAKRIKAT RDKDFMVKNA KGQVVNRLES ISHLGSSKLD NEECWMVTAA       180
     VRALGLVYID HQARV                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page