(data stored in ACNUC7421 zone)

EMBL: CP000478.PE341

CP000478.PE341       Location/Qualifiers
FT   CDS             complement(408046..409005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0345"
FT                   /product="protein of unknown function DUF402"
FT                   /note="PFAM: protein of unknown function DUF402; KEGG:
FT                   pfu:PF0022 putative RNase E"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16045"
FT                   /db_xref="InterPro:IPR007295"
FT                   /db_xref="InterPro:IPR035930"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF43"
FT                   /protein_id="ABK16045.1"
FT                   /translation="MTIRAKIRSIYSTALTKLLLDSGHRVVEPSVKIRERFSIEPCDET
FT                   HDVLLMDRDDFQGLDIFGEAESICRLLDCIRKHLLDAVLVELDQDDSDDGLMSARMELP
FT                   GASKEALDQLRYAVTPTLLRHHRLRIVDSTALERAEGTLSLHPEKKGELEKDLFLQAIL
FT                   APLEKAGVVRVEHVRPSGKSMRPREGVLVNATPESILFRRSFSKGGTYDGLDVPIQAGD
FT                   YGLTTIREGAWFVKHAYYTKDDKLIGEYYNVNTPVELYPYGARYLDLEVDVVKKAGRRP
FT                   RLLDREKLALLSRRGAIGSALESKAMAVAGELMQTLAG"
     MTIRAKIRSI YSTALTKLLL DSGHRVVEPS VKIRERFSIE PCDETHDVLL MDRDDFQGLD        60
     IFGEAESICR LLDCIRKHLL DAVLVELDQD DSDDGLMSAR MELPGASKEA LDQLRYAVTP       120
     TLLRHHRLRI VDSTALERAE GTLSLHPEKK GELEKDLFLQ AILAPLEKAG VVRVEHVRPS       180
     GKSMRPREGV LVNATPESIL FRRSFSKGGT YDGLDVPIQA GDYGLTTIRE GAWFVKHAYY       240
     TKDDKLIGEY YNVNTPVELY PYGARYLDLE VDVVKKAGRR PRLLDREKLA LLSRRGAIGS       300
     ALESKAMAVA GELMQTLAG                                                    319
//

If you have problems or comments...

PBIL Back to PBIL home page