(data stored in ACNUC7421 zone)

EMBL: CP000478.PE351

CP000478.PE351       Location/Qualifiers
FT   CDS             complement(417283..418182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0355"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: UbiE/COQ5 methyltransferase; Methyltransferase
FT                   type 11; Methyltransferase type 12; KEGG: dvu:DVU3369
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16055"
FT                   /db_xref="GOA:A0LF53"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF53"
FT                   /protein_id="ABK16055.1"
FT                   /translation="MERSVGYVFRPEDALMVEELSQTPAGRLALLIEQELLLRLWRPLT
FT                   PQRVLEVGCGTGLFLERLVREGHIVTGIDASPAMLEIARRRLAPRVALRQGFAEDLPFD
FT                   DNEFDTVALIGTLEYVNDPVAALREAFRVARQHVLLGAANRYSLETFKLCAQRLWKRSF
FT                   YDHARFYSVYRLRHLVERALAGSVPVRWGTCLSFPLGLLKYVRFLERSRLLQWHPLGHF
FT                   IGMRVDMVYPMQTIQTPLFAEVTSRMDRSRARASCWRSLAGDKGFCRFAPGLDGTGAFH
FT                   PPSTAGRMRISRPPISDR"
     MERSVGYVFR PEDALMVEEL SQTPAGRLAL LIEQELLLRL WRPLTPQRVL EVGCGTGLFL        60
     ERLVREGHIV TGIDASPAML EIARRRLAPR VALRQGFAED LPFDDNEFDT VALIGTLEYV       120
     NDPVAALREA FRVARQHVLL GAANRYSLET FKLCAQRLWK RSFYDHARFY SVYRLRHLVE       180
     RALAGSVPVR WGTCLSFPLG LLKYVRFLER SRLLQWHPLG HFIGMRVDMV YPMQTIQTPL       240
     FAEVTSRMDR SRARASCWRS LAGDKGFCRF APGLDGTGAF HPPSTAGRMR ISRPPISDR        299
//

If you have problems or comments...

PBIL Back to PBIL home page