(data stored in ACNUC7421 zone)

EMBL: CP000478.PE355

CP000478.PE355       Location/Qualifiers
FT   CDS             425356..427839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0359"
FT                   /product="alpha amylase, catalytic region"
FT                   /note="PFAM: glycoside hydrolase, family 13 domain protein;
FT                   alpha amylase, catalytic region; alpha amylase, C-terminal
FT                   all-beta; SMART: alpha amylase, catalytic sub domain; KEGG:
FT                   rba:RB548 1,4-alpha-glucan branching enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16059"
FT                   /db_xref="GOA:A0LF57"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR037439"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF57"
FT                   /protein_id="ABK16059.1"
FT                   /translation="MSWIPVHFTYHVGLQGGIFRNVRLVGSWDANGSHSDQWTGVPMRE
FT                   EVSDSGCPCFRATVNLNGDQAGWTFGWGVLLDGPGGANRWGITTEVHDRNSSERFRGFQ
FT                   LKGPEQFNEYHLTHCRRLGANKLHRPGGGEPAVRFAVWAPNALHVEMVRGDAATGYIDD
FT                   NGTGALAAFPMHKEMVDGTWTGIWRTDDDSEGLESFAQFDHTPYMFRITKDDDTVCYRT
FT                   DLYSRCQIGSGKKNPEGKKYDGRPTGLAGSVSCSVVVDPERVTELFDEPFPQKQWLDAD
FT                   EFWKNEFDPLRPVPTRIDDLVIYEMHVPGLGCGKTDAAGEPFTGDLKDAVQMLDYLVDL
FT                   GVNAVEVLPMNEFEGWAAWGYATSHYFAVEYAGGGRDQFKHFVRECHRRGLAVLLDVVY
FT                   NHYAHNAERAEWMYDSNRHEKNIYYWYEGMPSDYRDYEHAAGDPTLDPRKRPASGHGGY
FT                   VDNMSTGYAPRFCEEMVRKMFISSAAALVHEFHVDGFRVDQTTSIHSYAVVHADGRAAA
FT                   DARIFGAKFLRELTRTLKLIKPTVMLIAEDHSGWSAVTEPPDKGGLGFDAYWYADFYHH
FT                   LIGDTDKGADYAKLIKTCGFGDDRPLAVDYFVGALRHAGNLTVVYHESHDEAGNAKFSG
FT                   RTIAVAVNRATLSGETRRWAEARCRLACGLNMLSPGVPMFFMGEEVGFQKDYPYDLFLS
FT                   QREDFLRERGGSGANLFRFYQDIIKLRRRKPALRTAGLVPLHVRNDNRVLVFRRSLENE
FT                   HLIVFASFNNYAFVDGYRVNEAEIPDGAWREIFNSDAAVYGGNNVGNGGMVRESRYGSM
FT                   DAVIPANGFVVFERL"
     MSWIPVHFTY HVGLQGGIFR NVRLVGSWDA NGSHSDQWTG VPMREEVSDS GCPCFRATVN        60
     LNGDQAGWTF GWGVLLDGPG GANRWGITTE VHDRNSSERF RGFQLKGPEQ FNEYHLTHCR       120
     RLGANKLHRP GGGEPAVRFA VWAPNALHVE MVRGDAATGY IDDNGTGALA AFPMHKEMVD       180
     GTWTGIWRTD DDSEGLESFA QFDHTPYMFR ITKDDDTVCY RTDLYSRCQI GSGKKNPEGK       240
     KYDGRPTGLA GSVSCSVVVD PERVTELFDE PFPQKQWLDA DEFWKNEFDP LRPVPTRIDD       300
     LVIYEMHVPG LGCGKTDAAG EPFTGDLKDA VQMLDYLVDL GVNAVEVLPM NEFEGWAAWG       360
     YATSHYFAVE YAGGGRDQFK HFVRECHRRG LAVLLDVVYN HYAHNAERAE WMYDSNRHEK       420
     NIYYWYEGMP SDYRDYEHAA GDPTLDPRKR PASGHGGYVD NMSTGYAPRF CEEMVRKMFI       480
     SSAAALVHEF HVDGFRVDQT TSIHSYAVVH ADGRAAADAR IFGAKFLREL TRTLKLIKPT       540
     VMLIAEDHSG WSAVTEPPDK GGLGFDAYWY ADFYHHLIGD TDKGADYAKL IKTCGFGDDR       600
     PLAVDYFVGA LRHAGNLTVV YHESHDEAGN AKFSGRTIAV AVNRATLSGE TRRWAEARCR       660
     LACGLNMLSP GVPMFFMGEE VGFQKDYPYD LFLSQREDFL RERGGSGANL FRFYQDIIKL       720
     RRRKPALRTA GLVPLHVRND NRVLVFRRSL ENEHLIVFAS FNNYAFVDGY RVNEAEIPDG       780
     AWREIFNSDA AVYGGNNVGN GGMVRESRYG SMDAVIPANG FVVFERL                     827
//

If you have problems or comments...

PBIL Back to PBIL home page