(data stored in ACNUC7421 zone)

EMBL: CP000478.PE358

CP000478.PE358       Location/Qualifiers
FT   CDS             complement(429914..432646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0362"
FT                   /product="peptidase M16 domain protein"
FT                   /note="PFAM: peptidase M16 domain protein; KEGG:
FT                   mxa:MXAN_1141 peptidase, M16 (pitrilysin) family"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16062"
FT                   /db_xref="GOA:A0LF60"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF60"
FT                   /protein_id="ABK16062.1"
FT                   /translation="MICRLLFGICVALSLLGPGVVARCAAAQICPSLPPPLQPSVQRIL
FT                   SSKPGDLFVVLKNGLTLLMSQKPNYDVVSAQVFVRAGSIYEGKYLKSGLSHYLEHVVSG
FT                   GTTRSFTEDQAKERLKKIGGNSNAYTSHDRTVYYINTSAEHWKDALDLLLSYVSECTLE
FT                   PTEVAREKPVIQQEIKMGESNPSNELWKLFLRTAYQVSPVRNPVIGYEEVFVRLDRQAL
FT                   LDYYAQRYQPENIVVVVAGNISPEAVLSFVADKTKDFLGTAGEFDAVPVEPAQSTTRRQ
FT                   EKEIPVARLTQAMVGFPSVDLNHQDMYALDVLSLLLGGGETCRLHCRLKDMENKVLSVS
FT                   ASNWTPSYTKGQFIVSFTLPPDEWPGVLSQLGEEIEVFKRDLVPMKELDKAKKTAMASH
FT                   VFSNETVSSIAASLGSSYFSTGDPYYDDTYVEEIRRLTPEGIRSAAQRYLIMDRINVAA
FT                   TKPLSRQAAATPDTASCPPREASPAHMSKLDNGLKVLLKRDDSLPMVTMHLYGLGGLML
FT                   EDGDKPGIASLTSALMTSGTLTRTRQQILQSIEDVGGSIETQSENSTYHVSIKILKEDF
FT                   HTALDILADIVRNAQYPEEEIEKKRQDTLLAIQRMDESWQAEIVRLFKKNYFEKSPYRN
FT                   DRLGTRESVESISRDDLLRFHRRMVNPGQAVLAVYGDIDAEKTSERVRQLFGTWEQGEV
FT                   KYPELPDETTQISANRVVEKKNEKGSAALFVGTNGFAIRNSRRATLDVLDAVLSGAGNP
FT                   GGRIFEALRGKQDLVYVVGAFPFYGNNAGYFGVITQTTMANLDKVQGIILDNLRILARE
FT                   PVPADELEKAKSQIVTAHRLHMESLDAQAGSAAINEVLGLGWQYDKEYLKEVQAVGPAD
FT                   VRNLAKELFAHTLIARTIPERPVEVLSVPPPSKSDVRAQ"
     MICRLLFGIC VALSLLGPGV VARCAAAQIC PSLPPPLQPS VQRILSSKPG DLFVVLKNGL        60
     TLLMSQKPNY DVVSAQVFVR AGSIYEGKYL KSGLSHYLEH VVSGGTTRSF TEDQAKERLK       120
     KIGGNSNAYT SHDRTVYYIN TSAEHWKDAL DLLLSYVSEC TLEPTEVARE KPVIQQEIKM       180
     GESNPSNELW KLFLRTAYQV SPVRNPVIGY EEVFVRLDRQ ALLDYYAQRY QPENIVVVVA       240
     GNISPEAVLS FVADKTKDFL GTAGEFDAVP VEPAQSTTRR QEKEIPVARL TQAMVGFPSV       300
     DLNHQDMYAL DVLSLLLGGG ETCRLHCRLK DMENKVLSVS ASNWTPSYTK GQFIVSFTLP       360
     PDEWPGVLSQ LGEEIEVFKR DLVPMKELDK AKKTAMASHV FSNETVSSIA ASLGSSYFST       420
     GDPYYDDTYV EEIRRLTPEG IRSAAQRYLI MDRINVAATK PLSRQAAATP DTASCPPREA       480
     SPAHMSKLDN GLKVLLKRDD SLPMVTMHLY GLGGLMLEDG DKPGIASLTS ALMTSGTLTR       540
     TRQQILQSIE DVGGSIETQS ENSTYHVSIK ILKEDFHTAL DILADIVRNA QYPEEEIEKK       600
     RQDTLLAIQR MDESWQAEIV RLFKKNYFEK SPYRNDRLGT RESVESISRD DLLRFHRRMV       660
     NPGQAVLAVY GDIDAEKTSE RVRQLFGTWE QGEVKYPELP DETTQISANR VVEKKNEKGS       720
     AALFVGTNGF AIRNSRRATL DVLDAVLSGA GNPGGRIFEA LRGKQDLVYV VGAFPFYGNN       780
     AGYFGVITQT TMANLDKVQG IILDNLRILA REPVPADELE KAKSQIVTAH RLHMESLDAQ       840
     AGSAAINEVL GLGWQYDKEY LKEVQAVGPA DVRNLAKELF AHTLIARTIP ERPVEVLSVP       900
     PPSKSDVRAQ                                                              910
//

If you have problems or comments...

PBIL Back to PBIL home page