(data stored in ACNUC7421 zone)

EMBL: CP000478.PE359

CP000478.PE359       Location/Qualifiers
FT   CDS             complement(432918..433862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0363"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16063"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF61"
FT                   /protein_id="ABK16063.1"
FT                   /translation="MFWRVPRSIAIPCMERQSLSAAHPVYVALARGLESCAAVLTLGLR
FT                   ESIGAYSAEERDLLREARVVFFPSIRFVDVLEATGKRTFPSPSTYRFQRSRLQQELLIR
FT                   YLGIPHPRTRFYYGARQKRHILEGFEYPFLAMGPGHVSSPPRIVRNADDLGRACRAFNP
FT                   VVIQETPAWDERLRLICVGDACAGALRLHGGGGEAAGWEPVDIEAMRTGDARATRLPGG
FT                   SETAAGSTRVHGHTGSGKRAPGRGGAEAAVFRSTHDLMRTAGLDDMVFEWARAGTCWYL
FT                   VRMERPPSTWLTPAGRVHHGRHLCKLIQSGAFS"
     MFWRVPRSIA IPCMERQSLS AAHPVYVALA RGLESCAAVL TLGLRESIGA YSAEERDLLR        60
     EARVVFFPSI RFVDVLEATG KRTFPSPSTY RFQRSRLQQE LLIRYLGIPH PRTRFYYGAR       120
     QKRHILEGFE YPFLAMGPGH VSSPPRIVRN ADDLGRACRA FNPVVIQETP AWDERLRLIC       180
     VGDACAGALR LHGGGGEAAG WEPVDIEAMR TGDARATRLP GGSETAAGST RVHGHTGSGK       240
     RAPGRGGAEA AVFRSTHDLM RTAGLDDMVF EWARAGTCWY LVRMERPPST WLTPAGRVHH       300
     GRHLCKLIQS GAFS                                                         314
//

If you have problems or comments...

PBIL Back to PBIL home page