(data stored in ACNUC7421 zone)

EMBL: CP000478.PE37

CP000478.PE37        Location/Qualifiers
FT   CDS             52769..53779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0038"
FT                   /product="protein involved in formate dehydrogenase
FT                   formation"
FT                   /note="KEGG: sat:SYN_00636 protein involved in formate
FT                   dehydrogenase formation"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15741"
FT                   /db_xref="GOA:A0LE89"
FT                   /db_xref="InterPro:IPR006452"
FT                   /db_xref="InterPro:IPR024064"
FT                   /db_xref="UniProtKB/TrEMBL:A0LE89"
FT                   /protein_id="ABK15741.1"
FT                   /translation="MRNRDGRRLSEEEYLMEQESLAARAAGRVADALKKTSEENRYLRT
FT                   VLAPFAGLLMEQARWKAELPETEAGNALAPDATRFGNGIPVTDRQSLICLGDLWKEAAE
FT                   RLVPPFADGFAEVADGLRRLQYAILKGGFDPDSYWSRVLKNRNAAVPDEVRAIGLEPEV
FT                   LQFALIQLAKPVVERRAEGLQPLIKSLTWNKGYCPICGSLPELSLLKGKEGHRWLRCAF
FT                   CAGEWRFHRTTCPNCESQKPDDIELCYVEGREHERVELCHNCMTYVVSVDVRTLADEIV
FT                   PEVARLGLLHLDAIAQRREFRPMNPTGWTKSAPAGAAADEASGRASGASGGTMLH"
     MRNRDGRRLS EEEYLMEQES LAARAAGRVA DALKKTSEEN RYLRTVLAPF AGLLMEQARW        60
     KAELPETEAG NALAPDATRF GNGIPVTDRQ SLICLGDLWK EAAERLVPPF ADGFAEVADG       120
     LRRLQYAILK GGFDPDSYWS RVLKNRNAAV PDEVRAIGLE PEVLQFALIQ LAKPVVERRA       180
     EGLQPLIKSL TWNKGYCPIC GSLPELSLLK GKEGHRWLRC AFCAGEWRFH RTTCPNCESQ       240
     KPDDIELCYV EGREHERVEL CHNCMTYVVS VDVRTLADEI VPEVARLGLL HLDAIAQRRE       300
     FRPMNPTGWT KSAPAGAAAD EASGRASGAS GGTMLH                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page