(data stored in ACNUC7421 zone)

EMBL: CP000478.PE374

CP000478.PE374       Location/Qualifiers
FT   CDS             complement(451701..452891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0378"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   gme:Gmet_1823 extracellular ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16078"
FT                   /db_xref="GOA:A0LF76"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF76"
FT                   /protein_id="ABK16078.1"
FT                   /translation="MNGNTRLRVLFIVATAFALALCPLWTGARAADPIKIGAFFALSGP
FT                   ASSIGTPTKLVAQMVVDKINKEGGINGTPLELVVGDTESDPTKALMEAKRLIEAGKAAA
FT                   LIGPTRTDEGMAVKAYIEDTAHIPIVMTIGGDPVIAGGKFGPFKWTFKAPQRTSVAARK
FT                   TYDFIRSLKLTKIAVLTATDGFGKDGLTWLEQLAPEFGLEIVAKEAFGVTDTDMSPQLL
FT                   KIKASGAQAVICWTIGPAGARVAKNVKQLALGIPLVQCHGQPDPKYIELAGDAAEGSIM
FT                   PSTKLMVVDQLPDSDPQKAVIMEFIKLYTDVYHFDKQYPINTHSGYAWDAIYLAANAMR
FT                   KVGTDAEKLRAAIEQTKGYVGVSGVFNLTPEDHNGLGTDSLVMVKVEKGKWVLLKP"
     MNGNTRLRVL FIVATAFALA LCPLWTGARA ADPIKIGAFF ALSGPASSIG TPTKLVAQMV        60
     VDKINKEGGI NGTPLELVVG DTESDPTKAL MEAKRLIEAG KAAALIGPTR TDEGMAVKAY       120
     IEDTAHIPIV MTIGGDPVIA GGKFGPFKWT FKAPQRTSVA ARKTYDFIRS LKLTKIAVLT       180
     ATDGFGKDGL TWLEQLAPEF GLEIVAKEAF GVTDTDMSPQ LLKIKASGAQ AVICWTIGPA       240
     GARVAKNVKQ LALGIPLVQC HGQPDPKYIE LAGDAAEGSI MPSTKLMVVD QLPDSDPQKA       300
     VIMEFIKLYT DVYHFDKQYP INTHSGYAWD AIYLAANAMR KVGTDAEKLR AAIEQTKGYV       360
     GVSGVFNLTP EDHNGLGTDS LVMVKVEKGK WVLLKP                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page