(data stored in ACNUC7421 zone)

EMBL: CP000478.PE38

CP000478.PE38        Location/Qualifiers
FT   CDS             complement(53803..54669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0039"
FT                   /product="ABC transporter, periplasmic substrate-binding
FT                   protein, putative"
FT                   /note="KEGG: dvu:DVU0978 ABC transporter, periplasmic
FT                   substrate-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15742"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:A0LE90"
FT                   /protein_id="ABK15742.1"
FT                   /translation="MKALFFKAAVFSICLAIAGTGAVPSAGGEPCDGTYGSGPNRFVLA
FT                   TGSPGELGLVKALADVFTARTNTTLCWKKAGSGESLKMLKEKTADVIMGHSPDAEKKAV
FT                   AEGWAANHTLIGSNEFFIVGPATDPAGIANTSSAVEAYRKIAETKAKFFSRGDNSGTHK
FT                   KELQIWAKAGVTPSGDWYVVTKQFMIATLRMADSERGYFMTDSSTWVAEKKNLKNLKVL
FT                   LKGDKILVNVYHGLCQPPGSTPGAEWAAKFIAFVASDEGQNIIRGFGKDLHGEGLYNDA
FT                   AYAKQFE"
     MKALFFKAAV FSICLAIAGT GAVPSAGGEP CDGTYGSGPN RFVLATGSPG ELGLVKALAD        60
     VFTARTNTTL CWKKAGSGES LKMLKEKTAD VIMGHSPDAE KKAVAEGWAA NHTLIGSNEF       120
     FIVGPATDPA GIANTSSAVE AYRKIAETKA KFFSRGDNSG THKKELQIWA KAGVTPSGDW       180
     YVVTKQFMIA TLRMADSERG YFMTDSSTWV AEKKNLKNLK VLLKGDKILV NVYHGLCQPP       240
     GSTPGAEWAA KFIAFVASDE GQNIIRGFGK DLHGEGLYND AAYAKQFE                    288
//

If you have problems or comments...

PBIL Back to PBIL home page