(data stored in ACNUC7421 zone)

EMBL: CP000478.PE382

CP000478.PE382       Location/Qualifiers
FT   CDS             complement(462836..463363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0386"
FT                   /product="pyruvate ferredoxin/flavodoxin oxidoreductase"
FT                   /note="PFAM: pyruvate ferredoxin/flavodoxin oxidoreductase;
FT                   KEGG: gsu:GSU2052 indolepyruvate ferredoxin oxidoreductase,
FT                   beta subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16086"
FT                   /db_xref="GOA:A0LF84"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF84"
FT                   /protein_id="ABK16086.1"
FT                   /translation="MQQIIVSGIGGQGVLFVTKLLAQTAVDTGRSVLLSETHGMAQRGG
FT                   NVISHLKVAPREQSGTSPVSPLVRPGHADVLLALHPDALAAHGFFLRPGGRAFCNASGT
FT                   TAEGSLDASAIAGSLGSAVSANLVLLGFAAASGALFCDPAQLETTLARIGGKRTESSLA
FT                   AFRAGLKAASAP"
     MQQIIVSGIG GQGVLFVTKL LAQTAVDTGR SVLLSETHGM AQRGGNVISH LKVAPREQSG        60
     TSPVSPLVRP GHADVLLALH PDALAAHGFF LRPGGRAFCN ASGTTAEGSL DASAIAGSLG       120
     SAVSANLVLL GFAAASGALF CDPAQLETTL ARIGGKRTES SLAAFRAGLK AASAP            175
//

If you have problems or comments...

PBIL Back to PBIL home page