(data stored in ACNUC7421 zone)

EMBL: CP000478.PE387

CP000478.PE387       Location/Qualifiers
FT   CDS             complement(471519..472076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0391"
FT                   /product="protein of unknown function DUF162"
FT                   /note="PFAM: protein of unknown function DUF162; KEGG:
FT                   dde:Dde_3244 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16091"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF89"
FT                   /protein_id="ABK16091.1"
FT                   /translation="MDRGELIAKLKERAAAVQSVALEIGSFDAAMRYAVDLTARQGGRS
FT                   IAAPGLPDDRLSDLATLCAGRDIELLTGGLRQRLSGLHTGLTEADWGIAETATLVLDSS
FT                   AEDIRIATMLVETHVAILPASRLRATAFDLEPELGRMLRGRPSYLAFISGASRTADIER
FT                   VLTVGVHGPQELHILILEDNGS"
     MDRGELIAKL KERAAAVQSV ALEIGSFDAA MRYAVDLTAR QGGRSIAAPG LPDDRLSDLA        60
     TLCAGRDIEL LTGGLRQRLS GLHTGLTEAD WGIAETATLV LDSSAEDIRI ATMLVETHVA       120
     ILPASRLRAT AFDLEPELGR MLRGRPSYLA FISGASRTAD IERVLTVGVH GPQELHILIL       180
     EDNGS                                                                   185
//

If you have problems or comments...

PBIL Back to PBIL home page