(data stored in ACNUC7421 zone)

EMBL: CP000478.PE388

CP000478.PE388       Location/Qualifiers
FT   CDS             472346..473728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0392"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   dde:Dde_3239 glycolate oxidase, subunit GlcD"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16092"
FT                   /db_xref="GOA:A0LF90"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF90"
FT                   /protein_id="ABK16092.1"
FT                   /translation="MIGRALIAEFEKLLGRDNVFADEADRHTYSYDAAVLDPVLPALVV
FT                   RPTSSEGLGRSVRLCGENALPVTVRGAGTNLSGGTIPARGGVVIVTNGLNRILEINEAD
FT                   LYAVVEPGVVTARFAAAVESRGLFYPPDPGSQAVSTLGGNVAENAGGLRGLKYGVTGDY
FT                   VLGLSFFDANGEIVKTGARTVKCVAGYNLAGLMVGSEGTLGVFDRIILKLIPIPAARKA
FT                   MLAVFDDIAKACEAVSGIIADKIVPATLELMDNFTIRAVEDYGHAGLPVDAAALLLIEV
FT                   DGHAAQVEEDASRVEAVCRGRGAMSLRVARTAAERDKVWEARRAALSALAKLKPTVVLE
FT                   DATVPRSKIPAMMNSLEAIASRYRLTIGTFGHAGDGNLHPTILTDRRDRAEWSRVEAAI
FT                   DAIFDEALKLGGTLSGEHGIGLAKSRFLEKETSRATILYSRRIKTALDPKNILNPGKII
FT                   GE"
     MIGRALIAEF EKLLGRDNVF ADEADRHTYS YDAAVLDPVL PALVVRPTSS EGLGRSVRLC        60
     GENALPVTVR GAGTNLSGGT IPARGGVVIV TNGLNRILEI NEADLYAVVE PGVVTARFAA       120
     AVESRGLFYP PDPGSQAVST LGGNVAENAG GLRGLKYGVT GDYVLGLSFF DANGEIVKTG       180
     ARTVKCVAGY NLAGLMVGSE GTLGVFDRII LKLIPIPAAR KAMLAVFDDI AKACEAVSGI       240
     IADKIVPATL ELMDNFTIRA VEDYGHAGLP VDAAALLLIE VDGHAAQVEE DASRVEAVCR       300
     GRGAMSLRVA RTAAERDKVW EARRAALSAL AKLKPTVVLE DATVPRSKIP AMMNSLEAIA       360
     SRYRLTIGTF GHAGDGNLHP TILTDRRDRA EWSRVEAAID AIFDEALKLG GTLSGEHGIG       420
     LAKSRFLEKE TSRATILYSR RIKTALDPKN ILNPGKIIGE                             460
//

If you have problems or comments...

PBIL Back to PBIL home page