(data stored in ACNUC7421 zone)

EMBL: CP000478.PE39

CP000478.PE39        Location/Qualifiers
FT   CDS             55042..55374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0040"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dps:DP0127 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15743"
FT                   /db_xref="UniProtKB/TrEMBL:A0LE91"
FT                   /protein_id="ABK15743.1"
FT                   /translation="MKQYVIDQLRGPDYERIRDYLDANAEKTFMEDMYWVNLPPGLYSA
FT                   VQKEHESCHPFYFAVNLSPTQVDFEFLIRSRQIIRCSCIAYATAKQRDYIMDYADEMIR
FT                   RLDMKI"
     MKQYVIDQLR GPDYERIRDY LDANAEKTFM EDMYWVNLPP GLYSAVQKEH ESCHPFYFAV        60
     NLSPTQVDFE FLIRSRQIIR CSCIAYATAK QRDYIMDYAD EMIRRLDMKI                  110
//

If you have problems or comments...

PBIL Back to PBIL home page