(data stored in ACNUC7421 zone)

EMBL: CP000478.PE394

CP000478.PE394       Location/Qualifiers
FT   CDS             complement(480646..481314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0398"
FT                   /product="thymidylate kinase"
FT                   /EC_number="2.7.4.9"
FT                   /note="PFAM: thymidylate kinase; KEGG: tfu:Tfu_2783
FT                   thymidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16098"
FT                   /db_xref="GOA:A0LF96"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF96"
FT                   /protein_id="ABK16098.1"
FT                   /translation="MRPRPSIRVQMKPISPKFVTFEGIDGCGKSTLIDELASWLDRTRV
FT                   PYVKTREPGGTSLGEKIRGLLLDPAHRGMNRQTEVLLYTASRAQLVAEIILPALKSGAW
FT                   VLADRYIDATLAYQGYGRELDPDPLRRLQHWATQALVPDKTVLLDCGIDTAAARMSARN
FT                   HRPDRIEMEERAFHERVKAGYLDLASLDPGRFIVLDAEKPLPEVIADFRAAFREIVPAP
FT                   "
     MRPRPSIRVQ MKPISPKFVT FEGIDGCGKS TLIDELASWL DRTRVPYVKT REPGGTSLGE        60
     KIRGLLLDPA HRGMNRQTEV LLYTASRAQL VAEIILPALK SGAWVLADRY IDATLAYQGY       120
     GRELDPDPLR RLQHWATQAL VPDKTVLLDC GIDTAAARMS ARNHRPDRIE MEERAFHERV       180
     KAGYLDLASL DPGRFIVLDA EKPLPEVIAD FRAAFREIVP AP                          222
//

If you have problems or comments...

PBIL Back to PBIL home page