(data stored in ACNUC7421 zone)

EMBL: CP000478.PE395

CP000478.PE395       Location/Qualifiers
FT   CDS             complement(481336..481956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0399"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16099"
FT                   /db_xref="InterPro:IPR014871"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF97"
FT                   /protein_id="ABK16099.1"
FT                   /translation="MKDIFDRQMQLNIYTLRNIGLDFSTTVADPLEKTVWIENYRKAFS
FT                   AELAELVREVRERGVGTHNGRIEVVDLLHFLVSLSQIVGVAPSAAFSMMSDGNPGKGGV
FT                   AGGTAEQAVMECVVETFLALDDLQGCMKWKWWAKGGGFKPDMAEKAVLDLWKRFGEVCA
FT                   LFDLDFDTTKRIYTAKNEVNFRRQDRDYNEDTKDESDNLAIEA"
     MKDIFDRQMQ LNIYTLRNIG LDFSTTVADP LEKTVWIENY RKAFSAELAE LVREVRERGV        60
     GTHNGRIEVV DLLHFLVSLS QIVGVAPSAA FSMMSDGNPG KGGVAGGTAE QAVMECVVET       120
     FLALDDLQGC MKWKWWAKGG GFKPDMAEKA VLDLWKRFGE VCALFDLDFD TTKRIYTAKN       180
     EVNFRRQDRD YNEDTKDESD NLAIEA                                            206
//

If you have problems or comments...

PBIL Back to PBIL home page