(data stored in ACNUC7421 zone)

EMBL: CP000478.PE396

CP000478.PE396       Location/Qualifiers
FT   CDS             complement(482019..483035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0400"
FT                   /product="thymidylate synthase complementing protein ThyX"
FT                   /note="PFAM: thymidylate synthase complementing protein
FT                   ThyX; KEGG: dps:DP2228 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16100"
FT                   /db_xref="GOA:A0LF98"
FT                   /db_xref="InterPro:IPR003669"
FT                   /db_xref="InterPro:IPR036098"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF98"
FT                   /protein_id="ABK16100.1"
FT                   /translation="MSVQFVKTRVQPQGIAPAEEGRALQLVELCGRTAYKSEDKITPDS
FT                   ARNFVLMLKSHGHLSVLEHSNIVLEIEATPSSGATQALSSISELYGALLDGLGFRTAYH
FT                   RIHLSARTSPGALFIAGNLRSWIETLTHLGNGGSPLHALLSAALRDFFPIIFGGEETVS
FT                   SNLSFKVTLVREDEQLALLRRDAACDLPVFVFKFVCDRGITHEVVRHRVLSFTQESTRY
FT                   VNYKNKGMVLILPEELYPFYDDATQQLTGRSPLVDMWIDRAEKLFAWYREDLDREKPEI
FT                   ARDILPNLLKSEIFVSGRWSGWKHFVQLRDSKHAHPRIRAIAKEVRNHFDSLGMTVE"
     MSVQFVKTRV QPQGIAPAEE GRALQLVELC GRTAYKSEDK ITPDSARNFV LMLKSHGHLS        60
     VLEHSNIVLE IEATPSSGAT QALSSISELY GALLDGLGFR TAYHRIHLSA RTSPGALFIA       120
     GNLRSWIETL THLGNGGSPL HALLSAALRD FFPIIFGGEE TVSSNLSFKV TLVREDEQLA       180
     LLRRDAACDL PVFVFKFVCD RGITHEVVRH RVLSFTQEST RYVNYKNKGM VLILPEELYP       240
     FYDDATQQLT GRSPLVDMWI DRAEKLFAWY REDLDREKPE IARDILPNLL KSEIFVSGRW       300
     SGWKHFVQLR DSKHAHPRIR AIAKEVRNHF DSLGMTVE                               338
//

If you have problems or comments...

PBIL Back to PBIL home page