(data stored in ACNUC7421 zone)

EMBL: CP000478.PE398

CP000478.PE398       Location/Qualifiers
FT   CDS             484267..485043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0402"
FT                   /product="protein of unknown function DUF140"
FT                   /note="PFAM: protein of unknown function DUF140; KEGG:
FT                   gsu:GSU0817 putative ABC transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16102"
FT                   /db_xref="GOA:A0LFA0"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFA0"
FT                   /protein_id="ABK16102.1"
FT                   /translation="MTISSAFGLNGRRCVHAVRLAGRSLLFLGEALGYGFVPPLKIRRS
FT                   LEQIVFIGAKSLIIIFVTALSTGMVLALEALHMLRGGATENILGALVALSIVRELGPVL
FT                   SALIVTGRAGSAMTAEIGIMRLTEQIDALEMMAVNPIKHVVTPKIVAGVVSMPVLCAFF
FT                   DVVGILGGYFVGVVIYGVPEVHFFGGMTKAVAYLDVAGGLFKSAVFGLAMSWICSMMGY
FT                   GAAATAEGVSRATTNAVVITSIAVLVLDYMVTSLLL"
     MTISSAFGLN GRRCVHAVRL AGRSLLFLGE ALGYGFVPPL KIRRSLEQIV FIGAKSLIII        60
     FVTALSTGMV LALEALHMLR GGATENILGA LVALSIVREL GPVLSALIVT GRAGSAMTAE       120
     IGIMRLTEQI DALEMMAVNP IKHVVTPKIV AGVVSMPVLC AFFDVVGILG GYFVGVVIYG       180
     VPEVHFFGGM TKAVAYLDVA GGLFKSAVFG LAMSWICSMM GYGAAATAEG VSRATTNAVV       240
     ITSIAVLVLD YMVTSLLL                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page