(data stored in ACNUC7421 zone)

EMBL: CP000478.PE4

CP000478.PE4         Location/Qualifiers
FT   CDS             3935..4657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0004"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mca:MCA0862 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15708"
FT                   /db_xref="InterPro:IPR016936"
FT                   /db_xref="UniProtKB/TrEMBL:A0LE56"
FT                   /protein_id="ABK15708.1"
FT                   /translation="MTFVDTMINLMENELHGRVLGWRPNDIIVGRFTDNINNYQLGVLE
FT                   AIRFTTLRLKDSLTRMGDADTYDPDLEYALNLFMIRATSFWFPTAEGEYDKAIEHLRNF
FT                   RAKLEKGQRTFYYRKDNLISLLSVYKDLLGNVNKTLVVSPISWFQADDSFYYAKGVAHV
FT                   CYEILRVVRVGYQKQLASTMYGIEMMDTIVHELYRVENIDPWLILDSDLGSLLANHRAN
FT                   INAPLSEATHLMGILALL"
     MTFVDTMINL MENELHGRVL GWRPNDIIVG RFTDNINNYQ LGVLEAIRFT TLRLKDSLTR        60
     MGDADTYDPD LEYALNLFMI RATSFWFPTA EGEYDKAIEH LRNFRAKLEK GQRTFYYRKD       120
     NLISLLSVYK DLLGNVNKTL VVSPISWFQA DDSFYYAKGV AHVCYEILRV VRVGYQKQLA       180
     STMYGIEMMD TIVHELYRVE NIDPWLILDS DLGSLLANHR ANINAPLSEA THLMGILALL       240
//

If you have problems or comments...

PBIL Back to PBIL home page