(data stored in ACNUC7421 zone)

EMBL: CP000478.PE404

CP000478.PE404       Location/Qualifiers
FT   CDS             complement(489220..490572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0408"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mmp:MMP0898 cellulose-binding, bacterial type"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16108"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013431"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFA6"
FT                   /protein_id="ABK16108.1"
FT                   /translation="MRQSERANPYLGTIAAALFVFSVLCCGAARAGGTDEGRAILVDAH
FT                   GNVYVCAKSWRSSDQQFGIVTMKYSSSGKRLWARRFTDINNNGTWGQGSVALDGNGNFY
FT                   LTGQTLDRKLLVLKYTPAGSPVVSKYSFGGIPVGSGSNGRAIHVTPDGKGIYVTGEYWN
FT                   SSNSTWDIVTARLGPDPDMEWTTRRIASKHQFARAMVVGTNGNVTVTGQNFDAEADTYD
FT                   YLTIKYNALGKIEWAKTYNKGTWDEPFSVAVDPGGNAIVTGSAGSAEATRDFVTVKYSP
FT                   GGVQSPAWIYDGAAHALDYAETVKTDANGNVYVAGTSSGAYNWDIVLLKYNSSGQKVWT
FT                   RSYSNLCNDFFDEMALDKNGNIYVAGHSGSGGSGTWDYLTMKYNPNGKRAWTKFFNSSH
FT                   NSADMALSLTVDGSANVYVTGKSYNGTDYDCLTVKYDTNGNLVWSRRYDSA"
     MRQSERANPY LGTIAAALFV FSVLCCGAAR AGGTDEGRAI LVDAHGNVYV CAKSWRSSDQ        60
     QFGIVTMKYS SSGKRLWARR FTDINNNGTW GQGSVALDGN GNFYLTGQTL DRKLLVLKYT       120
     PAGSPVVSKY SFGGIPVGSG SNGRAIHVTP DGKGIYVTGE YWNSSNSTWD IVTARLGPDP       180
     DMEWTTRRIA SKHQFARAMV VGTNGNVTVT GQNFDAEADT YDYLTIKYNA LGKIEWAKTY       240
     NKGTWDEPFS VAVDPGGNAI VTGSAGSAEA TRDFVTVKYS PGGVQSPAWI YDGAAHALDY       300
     AETVKTDANG NVYVAGTSSG AYNWDIVLLK YNSSGQKVWT RSYSNLCNDF FDEMALDKNG       360
     NIYVAGHSGS GGSGTWDYLT MKYNPNGKRA WTKFFNSSHN SADMALSLTV DGSANVYVTG       420
     KSYNGTDYDC LTVKYDTNGN LVWSRRYDSA                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page