(data stored in ACNUC7421 zone)

EMBL: CP000478.PE405

CP000478.PE405       Location/Qualifiers
FT   CDS             complement(491264..491563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0409"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /note="TIGRFAM: transcriptional regulator, AbrB family;
FT                   PFAM: SpoVT/AbrB domain protein; KEGG: pfu:PF0573
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16109"
FT                   /db_xref="GOA:A0LFA7"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFA7"
FT                   /protein_id="ABK16109.1"
FT                   /translation="MPLVRVIRNGQITIPKKLRATLGIEEGDLLEVKLSQGGMTIKPKT
FT                   AVDKELSKGRFFRMVEEIRESVKDADPREVDAALAEAVRAAGKATSKKMKPRRS"
     MPLVRVIRNG QITIPKKLRA TLGIEEGDLL EVKLSQGGMT IKPKTAVDKE LSKGRFFRMV        60
     EEIRESVKDA DPREVDAALA EAVRAAGKAT SKKMKPRRS                               99
//

If you have problems or comments...

PBIL Back to PBIL home page