(data stored in ACNUC7421 zone)

EMBL: CP000478.PE406

CP000478.PE406       Location/Qualifiers
FT   CDS             complement(492634..496077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0410"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bth:BT4627 DNA modification methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16110"
FT                   /db_xref="GOA:A0LFA8"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR011639"
FT                   /db_xref="InterPro:IPR025931"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFA8"
FT                   /protein_id="ABK16110.1"
FT                   /translation="MDKQQARKLIKQTFEQPFEKTRFTTLIKNLLNRCEEAPLSYKGQY
FT                   IPDAYKPYISALDRIGKFHDGEHAVDILVIKLKKETSLERARTMQRNFVAWYLNGSRGD
FT                   KLKDAALVAFVSPEETDWRFSLVKMDYRFEQTKTGKMKVKEEFTPARRWSFLVGTNEQS
FT                   HTAQSRLINLLANDEQTPTLAELEEAFNIETVTTEFFLKYRDLFIRTKEALDRVVRGDP
FT                   RIEAEFEAKQVNTVDFAKKLLGQIVFLYFLQKKGWFGVGRDAPWGTGSRQFLRELFEQK
FT                   HGRYGNFFDDILEPLFYEALRNDRSHDDDYYSRFNCKIPFLNGGLFDPIDDYDWVHTNI
FT                   NLPDSLFSNQNRTAEGDIGDGILDIFDRYNFTVKEDEPLEKEVAIDPELLGKAYEKFNA
FT                   IRPDNFEEYKQVLRSGKKGDENKFNKQFGVYYTPREIVHYMCRQSLINYLHTELGKDIV
FT                   THKKLFEKQTTMFGNQAKRGQLDCTIEYKLTPQISRKDIETLIHLGEQVSANEARVENK
FT                   GKETVTYSYKLPESIRKNAGPIDRKLADITVCDPAVGSGAFPVGMMTEIVRTRNVLSTF
FT                   IQEDKPTPYDLKRRCIEHSLYGVDIDAGAVEIAKLRLWLSLIVDEDDIKNIKPLPNLEY
FT                   KIVCGDSLLGYPYKPMGLDEVEKLKEQFLEEVNPKRKKELRNRIDAAIYGLFKNTEKSL
FT                   GYQVTMDFRTNFSEVFRTKGGFDVVVANPPYVRQEAIRHLKPKFKKIFKDFYCGTADIY
FT                   TYFYKCGVDLLKSNGHLCFIAPNKFMRASYGKNTRTLLTTRATPRLVIDFGDLPIFDAT
FT                   TYPSILLIEKRKPDGRDKAVTATFTDASQLAKLEDSLLDIAFLMPVKALSKEGWNLERS
FT                   DVLSLMEKLKKIGVPLGEYIQGRFYRGVLTGLNKAFVIDAATRERLIAEDPASADVIKP
FT                   WLRGRDIRKWKAEWAGLYVINIASSSNKTWPWSNVKTEAEAVRQFEETYPAIYRHLAPW
FT                   EKELQKRDDQGKFWWELRSCAYYEAFEGTKIIYPDISQASKFSWDQSNSYLGNTVYMIP
FT                   TDKLWLVGLLNSKFIWWYYSNITSTIRGGFVRFFSQYMETIPISLISDSQKTSIIERTR
FT                   AILAAPGSPAVPTLEAEIDQIVYVLYNLTPEEIRIVEGVN"
     MDKQQARKLI KQTFEQPFEK TRFTTLIKNL LNRCEEAPLS YKGQYIPDAY KPYISALDRI        60
     GKFHDGEHAV DILVIKLKKE TSLERARTMQ RNFVAWYLNG SRGDKLKDAA LVAFVSPEET       120
     DWRFSLVKMD YRFEQTKTGK MKVKEEFTPA RRWSFLVGTN EQSHTAQSRL INLLANDEQT       180
     PTLAELEEAF NIETVTTEFF LKYRDLFIRT KEALDRVVRG DPRIEAEFEA KQVNTVDFAK       240
     KLLGQIVFLY FLQKKGWFGV GRDAPWGTGS RQFLRELFEQ KHGRYGNFFD DILEPLFYEA       300
     LRNDRSHDDD YYSRFNCKIP FLNGGLFDPI DDYDWVHTNI NLPDSLFSNQ NRTAEGDIGD       360
     GILDIFDRYN FTVKEDEPLE KEVAIDPELL GKAYEKFNAI RPDNFEEYKQ VLRSGKKGDE       420
     NKFNKQFGVY YTPREIVHYM CRQSLINYLH TELGKDIVTH KKLFEKQTTM FGNQAKRGQL       480
     DCTIEYKLTP QISRKDIETL IHLGEQVSAN EARVENKGKE TVTYSYKLPE SIRKNAGPID       540
     RKLADITVCD PAVGSGAFPV GMMTEIVRTR NVLSTFIQED KPTPYDLKRR CIEHSLYGVD       600
     IDAGAVEIAK LRLWLSLIVD EDDIKNIKPL PNLEYKIVCG DSLLGYPYKP MGLDEVEKLK       660
     EQFLEEVNPK RKKELRNRID AAIYGLFKNT EKSLGYQVTM DFRTNFSEVF RTKGGFDVVV       720
     ANPPYVRQEA IRHLKPKFKK IFKDFYCGTA DIYTYFYKCG VDLLKSNGHL CFIAPNKFMR       780
     ASYGKNTRTL LTTRATPRLV IDFGDLPIFD ATTYPSILLI EKRKPDGRDK AVTATFTDAS       840
     QLAKLEDSLL DIAFLMPVKA LSKEGWNLER SDVLSLMEKL KKIGVPLGEY IQGRFYRGVL       900
     TGLNKAFVID AATRERLIAE DPASADVIKP WLRGRDIRKW KAEWAGLYVI NIASSSNKTW       960
     PWSNVKTEAE AVRQFEETYP AIYRHLAPWE KELQKRDDQG KFWWELRSCA YYEAFEGTKI      1020
     IYPDISQASK FSWDQSNSYL GNTVYMIPTD KLWLVGLLNS KFIWWYYSNI TSTIRGGFVR      1080
     FFSQYMETIP ISLISDSQKT SIIERTRAIL AAPGSPAVPT LEAEIDQIVY VLYNLTPEEI      1140
     RIVEGVN                                                                1147
//

If you have problems or comments...

PBIL Back to PBIL home page