(data stored in ACNUC7421 zone)

EMBL: CP000478.PE408

CP000478.PE408       Location/Qualifiers
FT   CDS             500176..501096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0412"
FT                   /product="UbiA prenyltransferase"
FT                   /note="PFAM: UbiA prenyltransferase; KEGG: cps:CPS_4233
FT                   UbiA prenyltransferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16112"
FT                   /db_xref="GOA:A0LFB0"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR026046"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFB0"
FT                   /protein_id="ABK16112.1"
FT                   /translation="MGRLILWFKETRPQFLFLSVVLAFLGTAIAWYYGSFNLGYALLAG
FT                   FGLVLTHGSANAINDYFDYKSGIDLHVVRTPFSGGSGLVPDGKLPLGHALWVGVVTSVA
FT                   ALMIGVFFVIVSGWQLIPLLVAAILCLVLYTPVILRTNRPEWSPGLGLGILPIMGFYFV
FT                   QTGRYDWVVLVASVPSGILVHNLLLLNEFPDVEADRMGGRKTTPVVYGMEAAARVFRIA
FT                   TVSVYVWIVGCVLLTVATGRVVMPVYCLIALFTLPLAVKAMRGAGEYRDMSRLVPALGT
FT                   NVMFILLTQVLLGVGYILGKIFPIS"
     MGRLILWFKE TRPQFLFLSV VLAFLGTAIA WYYGSFNLGY ALLAGFGLVL THGSANAIND        60
     YFDYKSGIDL HVVRTPFSGG SGLVPDGKLP LGHALWVGVV TSVAALMIGV FFVIVSGWQL       120
     IPLLVAAILC LVLYTPVILR TNRPEWSPGL GLGILPIMGF YFVQTGRYDW VVLVASVPSG       180
     ILVHNLLLLN EFPDVEADRM GGRKTTPVVY GMEAAARVFR IATVSVYVWI VGCVLLTVAT       240
     GRVVMPVYCL IALFTLPLAV KAMRGAGEYR DMSRLVPALG TNVMFILLTQ VLLGVGYILG       300
     KIFPIS                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page