(data stored in ACNUC7421 zone)

EMBL: CP000478.PE41

CP000478.PE41        Location/Qualifiers
FT   CDS             56834..57076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0042"
FT                   /product="ATP-dependent Clp protease adaptor protein ClpS"
FT                   /note="PFAM: ATP-dependent Clp protease adaptor protein
FT                   ClpS; KEGG: pca:Pcar_2261 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15745"
FT                   /db_xref="GOA:A0LE93"
FT                   /db_xref="InterPro:IPR003769"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR022935"
FT                   /db_xref="UniProtKB/TrEMBL:A0LE93"
FT                   /protein_id="ABK15745.1"
FT                   /translation="MYRVLLHNDDYTTMEFVVEILQSVFHKSPSEATRIMLLVHKSGTG
FT                   VCGVFTAEVAETKVELVHHLARKNGFPLQCSMEET"
     MYRVLLHNDD YTTMEFVVEI LQSVFHKSPS EATRIMLLVH KSGTGVCGVF TAEVAETKVE        60
     LVHHLARKNG FPLQCSMEET                                                    80
//

If you have problems or comments...

PBIL Back to PBIL home page