(data stored in ACNUC7421 zone)

EMBL: CP000478.PE410

CP000478.PE410       Location/Qualifiers
FT   CDS             complement(503385..504272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0414"
FT                   /product="3'-5' exonuclease"
FT                   /note="PFAM: HRDC domain protein; 3'-5' exonuclease; KEGG:
FT                   ade:Adeh_1602 3'-5' exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16114"
FT                   /db_xref="GOA:A0LFB2"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFB2"
FT                   /protein_id="ABK16114.1"
FT                   /translation="MNPVVVIEKPSELDALVRQLSTARHLAVDTESNSFYAYFDRVCLI
FT                   QISSPERDYIIDPLSLKDLSVLGRLFENPRIEKVLHAASNDVLGLRRDFQFRFNGLFDT
FT                   AIACKLLGYKQLGLSKILETHFGVSLNKRWQRYDWGKRPLVPDQLDYARLDTHYLIALR
FT                   HMLAADLQSRELWAEACEAFEKASEQQVPEKTFHPRGFLQINGARSLDAAGKSILKALY
FT                   MFREKEARRRDRAPFRIMSNEALLRLADARPDSVDEISRIKGLPRSFHDPKAASFLIEI
FT                   IRQNNNSNDTEARE"
     MNPVVVIEKP SELDALVRQL STARHLAVDT ESNSFYAYFD RVCLIQISSP ERDYIIDPLS        60
     LKDLSVLGRL FENPRIEKVL HAASNDVLGL RRDFQFRFNG LFDTAIACKL LGYKQLGLSK       120
     ILETHFGVSL NKRWQRYDWG KRPLVPDQLD YARLDTHYLI ALRHMLAADL QSRELWAEAC       180
     EAFEKASEQQ VPEKTFHPRG FLQINGARSL DAAGKSILKA LYMFREKEAR RRDRAPFRIM       240
     SNEALLRLAD ARPDSVDEIS RIKGLPRSFH DPKAASFLIE IIRQNNNSND TEARE            295
//

If you have problems or comments...

PBIL Back to PBIL home page