(data stored in ACNUC7421 zone)

EMBL: CP000478.PE412

CP000478.PE412       Location/Qualifiers
FT   CDS             complement(505267..505824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0416"
FT                   /product="Rubrerythrin"
FT                   /note="PFAM: Rubrerythrin; KEGG: gsu:GSU3293 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16116"
FT                   /db_xref="GOA:A0LFB4"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFB4"
FT                   /protein_id="ABK16116.1"
FT                   /translation="MDSRVNLFCASGCRPKHDGYVEQFNKQTQEVEMSTVSCSSMDDVI
FT                   NFAISREEAAMDFYQKCADRARNPGIKKFFQEMVQEEERHRALLKDLNPMDLGTLTLDK
FT                   VEDLRISDYLVEVKFTEQVTYQEALTLAMKKEEKAHAFYEAWKNKCMHEKTAKLFEMLA
FT                   VEELKHKRKIETLYDEEILTWD"
     MDSRVNLFCA SGCRPKHDGY VEQFNKQTQE VEMSTVSCSS MDDVINFAIS REEAAMDFYQ        60
     KCADRARNPG IKKFFQEMVQ EEERHRALLK DLNPMDLGTL TLDKVEDLRI SDYLVEVKFT       120
     EQVTYQEALT LAMKKEEKAH AFYEAWKNKC MHEKTAKLFE MLAVEELKHK RKIETLYDEE       180
     ILTWD                                                                   185
//

If you have problems or comments...

PBIL Back to PBIL home page