(data stored in ACNUC7421 zone)

EMBL: CP000478.PE415

CP000478.PE415       Location/Qualifiers
FT   CDS             complement(508345..509715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0419"
FT                   /product="tRNA-i(6)A37 thiotransferase enzyme MiaB"
FT                   /note="KEGG: sat:SYN_02149 tRNA 2-methylthioadenosine
FT                   synthase; TIGRFAM: RNA modification enzyme, MiaB family;
FT                   tRNA-i(6)A37 thiotransferase enzyme MiaB; PFAM:
FT                   deoxyribonuclease/rho motif-related TRAM; Radical SAM
FT                   domain protein; Protein of unknown function UPF0004-like;
FT                   SMART: Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16119"
FT                   /db_xref="GOA:A0LFB7"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006463"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0LFB7"
FT                   /protein_id="ABK16119.1"
FT                   /translation="MITPLAKTAPAPRYLYVRTFGCQMNEYDSQRALRLLCAVGYRPTS
FT                   DIADADVIFLNTCSVRDKAEQKVYSFLGRLRRLKAHRPWLKIVVAGCVAQQLGDGLLKR
FT                   FEHVDLVVGTRGIGSIASLLEEVERSKRRVAHLPAEELQGFTTDKCRTVGTGDVVAQVT
FT                   IMQGCNNFCTYCIVPHVRGRERSRAPDDILREIDFLASRGAREVLLLGQNVNSYGRGLP
FT                   DPISFPDLLRRIGKETSIRRVRFTTSHPKDLTEDLIECFAGLPFLCKHLHLPFQSGSDG
FT                   ILKLMHRGYTARQYLEKIARLREVCPEIALSTDVIVGFPAESEEDYLQTLRLIEEVRFD
FT                   SLFSFRYSDRPLTRAAGFPDKVPMDVKVRRLARLQSIQADITLQKNLAETGTVREVLVE
FT                   GPSKASNGQMTGRTQQNRIINFQCPVDLTGKIVPVRIVAAYSHSLKGELLSQPGKES"
     MITPLAKTAP APRYLYVRTF GCQMNEYDSQ RALRLLCAVG YRPTSDIADA DVIFLNTCSV        60
     RDKAEQKVYS FLGRLRRLKA HRPWLKIVVA GCVAQQLGDG LLKRFEHVDL VVGTRGIGSI       120
     ASLLEEVERS KRRVAHLPAE ELQGFTTDKC RTVGTGDVVA QVTIMQGCNN FCTYCIVPHV       180
     RGRERSRAPD DILREIDFLA SRGAREVLLL GQNVNSYGRG LPDPISFPDL LRRIGKETSI       240
     RRVRFTTSHP KDLTEDLIEC FAGLPFLCKH LHLPFQSGSD GILKLMHRGY TARQYLEKIA       300
     RLREVCPEIA LSTDVIVGFP AESEEDYLQT LRLIEEVRFD SLFSFRYSDR PLTRAAGFPD       360
     KVPMDVKVRR LARLQSIQAD ITLQKNLAET GTVREVLVEG PSKASNGQMT GRTQQNRIIN       420
     FQCPVDLTGK IVPVRIVAAY SHSLKGELLS QPGKES                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page