(data stored in ACNUC7421 zone)

EMBL: CP000478.PE423

CP000478.PE423       Location/Qualifiers
FT   CDS             517092..517445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0427"
FT                   /product="LSU ribosomal protein L20P"
FT                   /note="TIGRFAM: ribosomal protein L20; KEGG: gme:Gmet_1414
FT                   50S ribosomal protein L20"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16127"
FT                   /db_xref="GOA:A0LFC5"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0LFC5"
FT                   /protein_id="ABK16127.1"
FT                   /translation="MPRVKKAVKSRERRKKILKLAKGYRGGRGKLIRSASETVDRALKF
FT                   AYRDRKTRKRQFRSLWIMRINAAAREHDLSYSRFMHALKKANIDMDRKALAHLAVNDPA
FT                   AFAKLARIAKEAA"
     MPRVKKAVKS RERRKKILKL AKGYRGGRGK LIRSASETVD RALKFAYRDR KTRKRQFRSL        60
     WIMRINAAAR EHDLSYSRFM HALKKANIDM DRKALAHLAV NDPAAFAKLA RIAKEAA          117
//

If you have problems or comments...

PBIL Back to PBIL home page