(data stored in ACNUC7421 zone)

EMBL: CP000478.PE424

CP000478.PE424       Location/Qualifiers
FT   CDS             517447..518457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0428"
FT                   /product="phenylalanyl-tRNA synthetase, alpha subunit"
FT                   /EC_number="6.1.1.20"
FT                   /note="KEGG: gsu:GSU1519 phenylalanyl-tRNA synthetase,
FT                   alpha subunit; TIGRFAM: phenylalanyl-tRNA synthetase, alpha
FT                   subunit; PFAM: phenylalanyl-tRNA synthetase, class IIc;
FT                   aminoacyl tRNA synthetase, class II domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16128"
FT                   /db_xref="GOA:A0LFC6"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004188"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR022911"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0LFC6"
FT                   /protein_id="ABK16128.1"
FT                   /translation="MEDAVRKLLNSADHEVLALANDARAIEQLKVRFLGRKGELARLFK
FT                   EMGKVPEAERPAVGKVLNEAKVRLEALFAEALERGGEQGAGRREQIDITVPGRRPPRGR
FT                   LHPISQVAREVCRIFNWLGFEIVEGPEVELDYYNFEALNIPRDHPARDMQDTFYVSDDV
FT                   VLRTHTSPLQVRTMEKRRPPIRVIAPGKTYRCDSDVTHTPMFHQVEGLMVGKDISFGDL
FT                   KGILTIFVHQMFGADVGLRFRPSFFPFTEPSAEVDIQCVMCKGEGCRVCSQTGWLEILG
FT                   SGMVDPEVFRMVGYDPEEVTGFAFGMGIERITMLKYGIDDLRLFFENDFRFLRQF"
     MEDAVRKLLN SADHEVLALA NDARAIEQLK VRFLGRKGEL ARLFKEMGKV PEAERPAVGK        60
     VLNEAKVRLE ALFAEALERG GEQGAGRREQ IDITVPGRRP PRGRLHPISQ VAREVCRIFN       120
     WLGFEIVEGP EVELDYYNFE ALNIPRDHPA RDMQDTFYVS DDVVLRTHTS PLQVRTMEKR       180
     RPPIRVIAPG KTYRCDSDVT HTPMFHQVEG LMVGKDISFG DLKGILTIFV HQMFGADVGL       240
     RFRPSFFPFT EPSAEVDIQC VMCKGEGCRV CSQTGWLEIL GSGMVDPEVF RMVGYDPEEV       300
     TGFAFGMGIE RITMLKYGID DLRLFFENDF RFLRQF                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page