(data stored in ACNUC7421 zone)

EMBL: CP000478.PE427

CP000478.PE427       Location/Qualifiers
FT   CDS             521762..522310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0431"
FT                   /product="protein of unknown function DUF204"
FT                   /note="PFAM: protein of unknown function DUF204; KEGG:
FT                   pca:Pcar_2070 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16131"
FT                   /db_xref="GOA:A0LFC9"
FT                   /db_xref="InterPro:IPR003810"
FT                   /db_xref="InterPro:IPR022929"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0LFC9"
FT                   /protein_id="ABK16131.1"
FT                   /translation="MSVVETVLVALALGCDAFAVGMGVGTRFCNPRQIFRLSFHFGLFQ
FT                   MMMPIAGWFVGSRAADLVSTWGPWISFALLLFIGGKMAYESFRSLEAEDGECPDPTKGS
FT                   SLVMLSVATSMDALGVGFSFGILGQQLFLSAVWIGITAGIMTWGAMRLGNRLSRQFGRR
FT                   METVGGLILVAIAVKLLLF"
     MSVVETVLVA LALGCDAFAV GMGVGTRFCN PRQIFRLSFH FGLFQMMMPI AGWFVGSRAA        60
     DLVSTWGPWI SFALLLFIGG KMAYESFRSL EAEDGECPDP TKGSSLVMLS VATSMDALGV       120
     GFSFGILGQQ LFLSAVWIGI TAGIMTWGAM RLGNRLSRQF GRRMETVGGL ILVAIAVKLL       180
     LF                                                                      182
//

If you have problems or comments...

PBIL Back to PBIL home page