(data stored in ACNUC7421 zone)

EMBL: CP000478.PE429

CP000478.PE429       Location/Qualifiers
FT   CDS             525404..526213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0433"
FT                   /product="phosphoribosylformylglycinamidine synthase
FT                   subunit I"
FT                   /EC_number="6.3.5.3"
FT                   /note="TIGRFAM: phosphoribosylformylglycinamidine synthase
FT                   I; KEGG: sat:SYN_00522 phosphoribosylformylglycinamidine
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16133"
FT                   /db_xref="GOA:A0LFD1"
FT                   /db_xref="InterPro:IPR010075"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFD1"
FT                   /protein_id="ABK16133.1"
FT                   /translation="MSRVKALVLTGFGLNCDLETAYALTIVGADVERVHLNSLAQREKR
FT                   LADYRIFVVGGGFSWGDDHGAGVIMGMRLKHRLGDDLQAFVASGGIVIGICNGFQVLVN
FT                   LGLLPGFEPGVLKREVALINNDCGNFRDQWVNLIGNAASPCVLTEGIEAIELPVRHGEG
FT                   KFFAETDVLERLERRQQVILRYAGADGKVAGGAFPANPNGSVADIAGICDPTGRVAGLM
FT                   PHPEAFNDWTNHPEWTRKRELARRSGTVAPREGEGLKLFRNAVNYFR"
     MSRVKALVLT GFGLNCDLET AYALTIVGAD VERVHLNSLA QREKRLADYR IFVVGGGFSW        60
     GDDHGAGVIM GMRLKHRLGD DLQAFVASGG IVIGICNGFQ VLVNLGLLPG FEPGVLKREV       120
     ALINNDCGNF RDQWVNLIGN AASPCVLTEG IEAIELPVRH GEGKFFAETD VLERLERRQQ       180
     VILRYAGADG KVAGGAFPAN PNGSVADIAG ICDPTGRVAG LMPHPEAFND WTNHPEWTRK       240
     RELARRSGTV APREGEGLKL FRNAVNYFR                                         269
//

If you have problems or comments...

PBIL Back to PBIL home page