(data stored in ACNUC7421 zone)

EMBL: CP000478.PE430

CP000478.PE430       Location/Qualifiers
FT   CDS             526280..527131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0434"
FT                   /product="phosphoribosylglycinamide formyltransferase"
FT                   /EC_number="2.1.2.2"
FT                   /note="TIGRFAM: phosphoribosylglycinamide
FT                   formyltransferase; PFAM: formyl transferase domain protein;
FT                   KEGG: ade:Adeh_1254 phosphoribosylglycinamide
FT                   formyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16134"
FT                   /db_xref="GOA:A0LFD2"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR004607"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFD2"
FT                   /protein_id="ABK16134.1"
FT                   /translation="MSESDSRLRIAVLVSGSGTNLQALIDRARDGRLAAEIVVVASDRP
FT                   GIRGLARAEAAGIPARVVDYRGFLKQDWTVLERKLPVDVDAVDRAQNILHHEDREERLK
FT                   RLVRLMSAEAEMIAAIEAYRPDYVCLAGFMRLVTPFFLHHFNRAGKLRVINIHPALLPA
FT                   FPGQHGYEDTFSYGCRWGGITIHFVDEGEDSGPIIAQAVYPILPEDDVEKVRQRGLQLE
FT                   YEMYAQVINWLAAGRVELVPAAGGRARTVIRDPEYSRIMESWVRKVLDAGPQDCRFSDP
FT                   SA"
     MSESDSRLRI AVLVSGSGTN LQALIDRARD GRLAAEIVVV ASDRPGIRGL ARAEAAGIPA        60
     RVVDYRGFLK QDWTVLERKL PVDVDAVDRA QNILHHEDRE ERLKRLVRLM SAEAEMIAAI       120
     EAYRPDYVCL AGFMRLVTPF FLHHFNRAGK LRVINIHPAL LPAFPGQHGY EDTFSYGCRW       180
     GGITIHFVDE GEDSGPIIAQ AVYPILPEDD VEKVRQRGLQ LEYEMYAQVI NWLAAGRVEL       240
     VPAAGGRART VIRDPEYSRI MESWVRKVLD AGPQDCRFSD PSA                         283
//

If you have problems or comments...

PBIL Back to PBIL home page