(data stored in ACNUC7421 zone)

EMBL: CP000478.PE433

CP000478.PE433       Location/Qualifiers
FT   CDS             complement(528572..528688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0437"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16137"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFD5"
FT                   /protein_id="ABK16137.1"
FT                   /translation="MSKDKKETVLPENTPIGQAKTITIKGDGKRKIVREGSF"
     MSKDKKETVL PENTPIGQAK TITIKGDGKR KIVREGSF                                38
//

If you have problems or comments...

PBIL Back to PBIL home page