(data stored in ACNUC7421 zone)

EMBL: CP000478.PE437

CP000478.PE437       Location/Qualifiers
FT   CDS             532102..532671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0441"
FT                   /product="OsmC family protein"
FT                   /note="PFAM: OsmC family protein; KEGG: gsu:GSU2788
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16141"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFD9"
FT                   /protein_id="ABK16141.1"
FT                   /translation="MSFQAAEQRDERTVNGVDVNRLFDTIDAVKAEPEIAKFRFRVKNK
FT                   WIGGGHNHTTITDFYGALKDHPHEKPFELDADEPEVLLGEDKGPNPVEYLLTALAGCLT
FT                   SSLVYHAAAKGIELKGVESRLEGDLDLRGFLGLSKDVPVGYREIRVYFTIDADLSEQEK
FT                   QELIREAQKYSPVFNTVSNSTRVTVQ"
     MSFQAAEQRD ERTVNGVDVN RLFDTIDAVK AEPEIAKFRF RVKNKWIGGG HNHTTITDFY        60
     GALKDHPHEK PFELDADEPE VLLGEDKGPN PVEYLLTALA GCLTSSLVYH AAAKGIELKG       120
     VESRLEGDLD LRGFLGLSKD VPVGYREIRV YFTIDADLSE QEKQELIREA QKYSPVFNTV       180
     SNSTRVTVQ                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page