(data stored in ACNUC7421 zone)

EMBL: CP000478.PE438

CP000478.PE438       Location/Qualifiers
FT   CDS             533088..533588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0442"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /note="PFAM: Rieske [2Fe-2S] domain protein; KEGG:
FT                   gka:GK0894 menaquinol-cytochrome c reductase iron-sulfur
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16142"
FT                   /db_xref="GOA:A0LFE0"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFE0"
FT                   /protein_id="ABK16142.1"
FT                   /translation="MASDTTCGYPDESIRPGRRAFIKCALLAGATGVLAGVPLLSYVAA
FT                   PALKKGTTRWIDFGPVDQLKPGGIEMLSYEFMVKDGWLVLPQRGFVWAKLDSPGKITVF
FT                   SSTCTHLACNVIWRKEKGIFECPCHSGQFDINGRPIAGPPTKPLVAWAHKVEEGKLMVL
FT                   MPA"
     MASDTTCGYP DESIRPGRRA FIKCALLAGA TGVLAGVPLL SYVAAPALKK GTTRWIDFGP        60
     VDQLKPGGIE MLSYEFMVKD GWLVLPQRGF VWAKLDSPGK ITVFSSTCTH LACNVIWRKE       120
     KGIFECPCHS GQFDINGRPI AGPPTKPLVA WAHKVEEGKL MVLMPA                      166
//

If you have problems or comments...

PBIL Back to PBIL home page