(data stored in ACNUC7421 zone)

EMBL: CP000478.PE439

CP000478.PE439       Location/Qualifiers
FT   CDS             533619..534596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0443"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dps:DP3001 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16143"
FT                   /db_xref="GOA:A0LFE1"
FT                   /db_xref="InterPro:IPR019020"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFE1"
FT                   /protein_id="ABK16143.1"
FT                   /translation="MKTPAILLLFLAVLICGNAFMADLATSAAIETLAAAKVPKGPTSL
FT                   DDPVWQKAKPLDIPFAGKEKFAGKKANVITQAVYTDDEIFFLFKWKDATNSVTKGAWQF
FT                   DGEKWTHLKGDEDRISLLFEINRINNFATKGCAVTCHGAAGAAVKDFKFATASAGEKGD
FT                   LWHWKAARSDPYKSADDGWLTAAGEKTGRKDDAGGGGDARNETADKSKPQFMQDPSKKP
FT                   SAPGVLLAEDTVEITDHGKFKANDTLTYRMPKKPSGSRADIKAESRYADGGWTVMLSRK
FT                   LDTGNDDDVAFNTKKKYSFALALFDDSMDYDSYDSEALVLEFGR"
     MKTPAILLLF LAVLICGNAF MADLATSAAI ETLAAAKVPK GPTSLDDPVW QKAKPLDIPF        60
     AGKEKFAGKK ANVITQAVYT DDEIFFLFKW KDATNSVTKG AWQFDGEKWT HLKGDEDRIS       120
     LLFEINRINN FATKGCAVTC HGAAGAAVKD FKFATASAGE KGDLWHWKAA RSDPYKSADD       180
     GWLTAAGEKT GRKDDAGGGG DARNETADKS KPQFMQDPSK KPSAPGVLLA EDTVEITDHG       240
     KFKANDTLTY RMPKKPSGSR ADIKAESRYA DGGWTVMLSR KLDTGNDDDV AFNTKKKYSF       300
     ALALFDDSMD YDSYDSEALV LEFGR                                             325
//

If you have problems or comments...

PBIL Back to PBIL home page