(data stored in ACNUC7421 zone)

EMBL: CP000478.PE44

CP000478.PE44        Location/Qualifiers
FT   CDS             complement(60382..60672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0045"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15748"
FT                   /db_xref="GOA:A0LE96"
FT                   /db_xref="UniProtKB/TrEMBL:A0LE96"
FT                   /protein_id="ABK15748.1"
FT                   /translation="MRECPKCGHVRRQEDDGFVPAEECPKCGVIYSRARPDVSLQPYSN
FT                   RPAGKGIGETIKFVLLIALVLIGFYLWTHYYGSSAEGKSTFGLEFLMVPRG"
     MRECPKCGHV RRQEDDGFVP AEECPKCGVI YSRARPDVSL QPYSNRPAGK GIGETIKFVL        60
     LIALVLIGFY LWTHYYGSSA EGKSTFGLEF LMVPRG                                  96
//

If you have problems or comments...

PBIL Back to PBIL home page