(data stored in ACNUC7421 zone)

EMBL: CP000478.PE441

CP000478.PE441       Location/Qualifiers
FT   CDS             535711..536787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0445"
FT                   /product="Cytochrome b/b6, N-terminal domain"
FT                   /note="PFAM: Cytochrome b/b6, N-terminal domain; KEGG:
FT                   ade:Adeh_2404 cytochrome b/b6-like"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16145"
FT                   /db_xref="GOA:A0LFE3"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFE3"
FT                   /protein_id="ABK16145.1"
FT                   /translation="MNGTGQSSGKLLNRLALDGYAERLCAVRVASDAFGWTRFCGSLSL
FT                   VLVVMLFLSGAFLMFYYSPTPGAAYDSVDFAQFSVPFGDIVRGVHYYAWNLLLVVLGLH
FT                   LAGTFLTAAYQAPRQFVWISGVLIMLVVPLFIITGDLLPWDQKGYWTTQVRNSIISSIP
FT                   VVGDLTLRLLQGGPRTGIVTLTRFYVLHCLFLPSLLVALIVIHLHFLAHRGLSEPLREG
FT                   KTDRGCIPLVPDLINRWLLLFAAVAVVLGLVSAYWPAPLDSPADPTDSAYVPKPEWWVL
FT                   ALNQLVSIFKGPFMFIGTAVIPGGLAALLIALPFLDRSPSRHPAKRKTVMVLGVIMLIL
FT                   LSGLSLLGYIEHFMTPRP"
     MNGTGQSSGK LLNRLALDGY AERLCAVRVA SDAFGWTRFC GSLSLVLVVM LFLSGAFLMF        60
     YYSPTPGAAY DSVDFAQFSV PFGDIVRGVH YYAWNLLLVV LGLHLAGTFL TAAYQAPRQF       120
     VWISGVLIML VVPLFIITGD LLPWDQKGYW TTQVRNSIIS SIPVVGDLTL RLLQGGPRTG       180
     IVTLTRFYVL HCLFLPSLLV ALIVIHLHFL AHRGLSEPLR EGKTDRGCIP LVPDLINRWL       240
     LLFAAVAVVL GLVSAYWPAP LDSPADPTDS AYVPKPEWWV LALNQLVSIF KGPFMFIGTA       300
     VIPGGLAALL IALPFLDRSP SRHPAKRKTV MVLGVIMLIL LSGLSLLGYI EHFMTPRP         358
//

If you have problems or comments...

PBIL Back to PBIL home page