(data stored in ACNUC7421 zone)

EMBL: CP000478.PE443

CP000478.PE443       Location/Qualifiers
FT   CDS             538393..539931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0447"
FT                   /product="transcriptional regulator, Fis family"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT family; PFAM: outer membrane efflux
FT                   protein; KEGG: dde:Dde_0400 RND efflux system, outer
FT                   membrane lipoprotein, NodT"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16147"
FT                   /db_xref="GOA:A0LFE5"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFE5"
FT                   /protein_id="ABK16147.1"
FT                   /translation="MIDLQGMKRFRWTRSLILGLVAVVGGCMVGPNYRTPPSEMPGQWS
FT                   EEPKGVEVAAAPDISRWWTLFEDPKLNDLIERAVRANKDLKIAAARVREARAQRGVTAA
FT                   DLFPTVNADGSYVYSQKSLTTTNPPLVSSGSSPAATVGGVSTGSTNLFQVGFDAGWELD
FT                   LWGGTRRAVEAADANLAASVENLRGVLVTLVSDVAVSYMQIRGFQLRLGIARNNIASQR
FT                   QTLELTEARFEAGLSSELAVAQQKAQLAATEATVPAFESGMRQAIHQLGVLLGGKPELL
FT                   LEELLEEEPIPPVPPGVPAGLPSDLLRQRPDIRASERQLAAATASIGVATAQLFPQFSL
FT                   TGTVGQQSMFSSKWFTPGSNYFSIGPSVSWAIFDAGRIRWNIKVQDARQEQAFHTYEKT
FT                   ILVALKDVEDALIAYSKEQDTRESLKLAVDSNRRAYDISYELYAKGLVDFLNVLDAQRN
FT                   LFVTQDQYAQSTLRVSADLVALYKALGGGWDVPPEAAARPVARNAPENPVGQGQ"
     MIDLQGMKRF RWTRSLILGL VAVVGGCMVG PNYRTPPSEM PGQWSEEPKG VEVAAAPDIS        60
     RWWTLFEDPK LNDLIERAVR ANKDLKIAAA RVREARAQRG VTAADLFPTV NADGSYVYSQ       120
     KSLTTTNPPL VSSGSSPAAT VGGVSTGSTN LFQVGFDAGW ELDLWGGTRR AVEAADANLA       180
     ASVENLRGVL VTLVSDVAVS YMQIRGFQLR LGIARNNIAS QRQTLELTEA RFEAGLSSEL       240
     AVAQQKAQLA ATEATVPAFE SGMRQAIHQL GVLLGGKPEL LLEELLEEEP IPPVPPGVPA       300
     GLPSDLLRQR PDIRASERQL AAATASIGVA TAQLFPQFSL TGTVGQQSMF SSKWFTPGSN       360
     YFSIGPSVSW AIFDAGRIRW NIKVQDARQE QAFHTYEKTI LVALKDVEDA LIAYSKEQDT       420
     RESLKLAVDS NRRAYDISYE LYAKGLVDFL NVLDAQRNLF VTQDQYAQST LRVSADLVAL       480
     YKALGGGWDV PPEAAARPVA RNAPENPVGQ GQ                                     512
//

If you have problems or comments...

PBIL Back to PBIL home page